Clone LD09947 Report

Search the DGRC for LD09947

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:99
Well:47
Vector:pBS SK-
Associated Gene/TranscriptAnxB9-RB
Protein status:LD09947.pep: gold
Preliminary Size:1433
Sequenced Size:1217

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5730 2001-01-01 Release 2 assignment
CG5730 2002-05-30 Blastp of sequenced clone
CG5730 2003-01-01 Sim4 clustering to Release 3
AnnIX 2008-04-29 Release 5.5 accounting
AnnIX 2008-08-15 Release 5.9 accounting
AnnIX 2008-12-18 5.12 accounting

Clone Sequence Records

LD09947.complete Sequence

1217 bp (1217 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118504

> LD09947.complete
GAGCGCAAACAGCTATGGTATTTATTCACATCGCTTGCAGTTCGCATCGT
CTGACTTATTTTTCACAACAAACCAATCAAAATGAGTTCCGCTGAGTACT
ACCCATTCAAGTGCACACCCACTGTCTACCCGGCGGATCCCTTCGATCCC
GTCGAGGATGCGGCTATTCTGCGCAAGGCGATGAAAGGCTTCGGCACCGA
CGAGAAGGCCATCATCGAGATCCTGGCCAGGCGTGGCATCGTCCAGCGTT
TGGAGATCGCTGAGGCGTTCAAGACCTCGTACGGCAAGGACCTGATCTCG
GACCTCAAGTCCGAACTGGGCGGCAAATTCGAGGATGTTATCCTGGCTCT
GATGACGCCGCTGCCCCAGTTCTATGCCCAGGAGCTGCACGACGCCATCT
CGGGACTGGGAACCGACGAGGAGGCCATCATCGAGATCCTCTGCACGCTG
TCCAACTACGGCATCAAGACCATTGCCCAGTTCTACGAGCAGAGCTTCGG
CAAGTCCCTAGAGTCCGACCTGAAGGGCGACACCAGTGGCCACTTCAAGC
GGCTGTGTGTCTCGCTCGTCCAGGGCAACCGGGATGAGAACCAGGGCGTG
GACGAGGCCGCGGCCATCGCCGATGCCCAGGCTCTGCACGACGCCGGCGA
GGGACAGTGGGGCACAGATGAGTCCACCTTCAACTCGATCCTGATCACCC
GCTCCTACCAGCAGCTGCGCCAGATCTTCCTCGAATACGAGAATCTGTCG
GGCAACGACATCGAGAAGGCCATCAAGCGGGAGTTTAGCGGCTCCGTGGA
GAAGGGTTTCCTGGCCATCGTCAAGTGCTGCAAGTCCAAGATCGACTACT
TTTCGGAGCGCCTGCACGACTCAATGGCCGGCATGGGCACCAAGGACAAG
ACGCTGATCCGCATCATTGTCAGCCGGTCGGAGATCGATCTGGGTGACAT
CAAGGAGGCATTCCAGAACAAGTACGGCAAGAGCTTGGAGTCCTGGATCA
AGGACGACCTCTCCGGAGACTACAGCTACGTCTTGCAGTGCCTGGCCTCC
TACTAAGGATTTCCTCGTTGGATCGATTGTTAACCATTCTATTTGTTGTA
ACTCTTACTTTAAGGCAAGCATCGTTTGCCAACTGTTTTGCGGAAGATTC
ATAGCCTATGTTCAATTCATAAATGCACTGTAAAATCGCGGTAAATAAAA
AAAAAAAAAAAAAAAAA

LD09947.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
AnnIX-RB 1380 AnnIX-RB 117..1314 1..1198 5990 100 Plus
AnnIX-RD 1312 AnnIX-RD 174..1312 58..1196 5695 100 Plus
AnnIX.h 1826 AnnIX.h 117..1120 1..1004 5020 100 Plus
AnnIX.h 1826 AnnIX.h 1563..1760 1001..1198 990 100 Plus
AnnIX-RD 1312 AnnIX-RD 1..57 1..57 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16891939..16892649 110..820 3435 98.9 Plus
chr3R 27901430 chr3R 16894594..16894789 1001..1196 965 99.5 Plus
chr3R 27901430 chr3R 16892709..16892892 820..1003 875 98.4 Plus
chr3R 27901430 chr3R 16891315..16891368 58..111 270 100 Plus
chr3R 27901430 chr3R 16889097..16889153 1..57 270 98.2 Plus
chrX 22417052 chrX 16308433..16308507 456..382 225 86.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21068067..21068777 110..820 3555 100 Plus
3R 32079331 3R 21070722..21070919 1001..1198 990 100 Plus
3R 32079331 3R 21068837..21069020 820..1003 920 100 Plus
3R 32079331 3R 21065229..21065285 1..57 285 100 Plus
3R 32079331 3R 21067446..21067499 58..111 270 100 Plus
X 23542271 X 16418705..16418779 456..382 225 86.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20808898..20809608 110..820 3555 100 Plus
3R 31820162 3R 20811553..20811750 1001..1198 990 100 Plus
3R 31820162 3R 20809668..20809851 820..1003 920 100 Plus
3R 31820162 3R 20806060..20806116 1..57 285 100 Plus
3R 31820162 3R 20808277..20808330 58..111 270 100 Plus
X 23527363 X 16426803..16426877 456..382 225 86.6 Minus
Blast to na_te.dros performed on 2019-03-15 20:19:17 has no hits.

LD09947.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:20:05 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16889097..16889153 1..57 98 -> Plus
chr3R 16891315..16891368 58..111 100 -> Plus
chr3R 16891941..16892649 112..820 98 -> Plus
chr3R 16892710..16892891 821..1002 98 -> Plus
chr3R 16894596..16894789 1003..1196 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:12 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..975 82..1056 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:37:08 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..975 82..1056 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:51:43 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RD 1..975 82..1056 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:44 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..975 82..1056 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:09 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RD 1..975 82..1056 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:09:30 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..1196 1..1196 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:37:08 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..1196 1..1196 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:43 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RB 1..1184 13..1196 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:45 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..1196 1..1196 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:09 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RB 1..1184 13..1196 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:05 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21065229..21065285 1..57 100 -> Plus
3R 21067446..21067499 58..111 100 -> Plus
3R 21068069..21068777 112..820 100 -> Plus
3R 21068838..21069019 821..1002 100 -> Plus
3R 21070724..21070917 1003..1196 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:05 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21065229..21065285 1..57 100 -> Plus
3R 21067446..21067499 58..111 100 -> Plus
3R 21068069..21068777 112..820 100 -> Plus
3R 21068838..21069019 821..1002 100 -> Plus
3R 21070724..21070917 1003..1196 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:05 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21065229..21065285 1..57 100 -> Plus
3R 21067446..21067499 58..111 100 -> Plus
3R 21068069..21068777 112..820 100 -> Plus
3R 21068838..21069019 821..1002 100 -> Plus
3R 21070724..21070917 1003..1196 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:43 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16890951..16891007 1..57 100 -> Plus
arm_3R 16893168..16893221 58..111 100 -> Plus
arm_3R 16893791..16894499 112..820 100 -> Plus
arm_3R 16894560..16894741 821..1002 100 -> Plus
arm_3R 16896446..16896639 1003..1196 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:19 Download gff for LD09947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20808900..20809608 112..820 100 -> Plus
3R 20809669..20809850 821..1002 100 -> Plus
3R 20811555..20811748 1003..1196 100   Plus
3R 20806060..20806116 1..57 100 -> Plus
3R 20808277..20808330 58..111 100 -> Plus

LD09947.pep Sequence

Translation from 81 to 1055

> LD09947.pep
MSSAEYYPFKCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILAR
RGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQ
ELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGD
TSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTF
NSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCC
KSKIDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGK
SLESWIKDDLSGDYSYVLQCLASY*

LD09947.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16493-PA 341 GF16493-PA 1..324 1..324 1573 94.8 Plus
Dana\GF19282-PA 356 GF19282-PA 40..350 12..322 918 57.2 Plus
Dana\GF20448-PA 321 GF20448-PA 4..317 9..321 681 46.8 Plus
Dana\GF19282-PA 356 GF19282-PA 47..192 171..323 201 33.3 Plus
Dana\GF19282-PA 356 GF19282-PA 201..354 18..167 178 31.8 Plus
Dana\GF20448-PA 321 GF20448-PA 168..320 17..165 162 27.9 Plus
Dana\GF20448-PA 321 GF20448-PA 97..318 30..247 161 26 Plus
Dana\GF20448-PA 321 GF20448-PA 32..159 193..323 153 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24321-PA 341 GG24321-PA 1..341 1..324 1670 94.7 Plus
Dere\GG19323-PA 505 GG19323-PA 189..498 12..321 902 57.1 Plus
Dere\GG18007-PA 320 GG18007-PA 3..316 9..321 714 45.5 Plus
Dere\GG19323-PA 505 GG19323-PA 200..341 178..323 212 33.6 Plus
Dere\GG19323-PA 505 GG19323-PA 270..499 23..247 180 30.1 Plus
Dere\GG19323-PA 505 GG19323-PA 371..503 38..167 179 33.1 Plus
Dere\GG18007-PA 320 GG18007-PA 20..158 181..323 172 30.1 Plus
Dere\GG18007-PA 320 GG18007-PA 167..317 17..163 154 27.6 Plus
Dere\GG18007-PA 320 GG18007-PA 96..317 30..247 151 25.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17323-PA 324 GH17323-PA 1..318 1..318 1612 95.9 Plus
Dgri\GH12030-PA 492 GH12030-PA 176..485 12..321 903 56.1 Plus
Dgri\GH12087-PA 320 GH12087-PA 3..309 9..314 695 45.9 Plus
Dgri\GH12030-PA 492 GH12030-PA 183..328 171..323 200 32.7 Plus
Dgri\GH17323-PA 324 GH17323-PA 179..322 24..163 193 32.6 Plus
Dgri\GH17323-PA 324 GH17323-PA 102..322 30..247 188 30.9 Plus
Dgri\GH12030-PA 492 GH12030-PA 337..490 18..167 182 33.1 Plus
Dgri\GH12030-PA 492 GH12030-PA 257..486 23..247 169 28.6 Plus
Dgri\GH12087-PA 320 GH12087-PA 17..158 178..323 155 27.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-PB 324 CG5730-PB 1..324 1..324 1659 100 Plus
AnxB9-PD 324 CG5730-PD 1..324 1..324 1659 100 Plus
AnxB9-PF 324 CG5730-PF 1..324 1..324 1600 96.6 Plus
AnxB9-PE 324 CG5730-PE 1..324 1..324 1600 96.6 Plus
AnxB9-PC 324 CG5730-PC 1..324 1..324 1600 96.6 Plus
AnxB9-PA 324 CG5730-PA 1..324 1..324 1597 96.6 Plus
AnxB11-PF 322 CG9968-PF 2..315 7..321 886 57.1 Plus
AnxB11-PC 322 CG9968-PC 2..315 7..321 886 57.1 Plus
AnxB11-PA 322 CG9968-PA 2..315 7..321 886 57.1 Plus
AnxB11-PG 511 CG9968-PG 195..504 12..321 880 57.1 Plus
AnxB11-PE 511 CG9968-PE 195..504 12..321 880 57.1 Plus
AnxB11-PB 511 CG9968-PB 195..504 12..321 880 57.1 Plus
AnxB11-PD 295 CG9968-PD 1..288 34..321 814 56.2 Plus
AnxB10-PA 320 CG9579-PA 3..316 9..321 687 45.9 Plus
AnxB10-PB 321 CG9579-PB 3..317 9..321 683 46 Plus
AnxB11-PG 511 CG9968-PG 178..347 149..323 215 32.6 Plus
AnxB11-PE 511 CG9968-PE 178..347 149..323 215 32.6 Plus
AnxB11-PB 511 CG9968-PB 178..347 149..323 215 32.6 Plus
AnxB11-PF 322 CG9968-PF 17..158 178..323 214 34.2 Plus
AnxB11-PC 322 CG9968-PC 17..158 178..323 214 34.2 Plus
AnxB11-PA 322 CG9968-PA 17..158 178..323 214 34.2 Plus
AnxB11-PD 295 CG9968-PD 4..131 193..323 201 33.6 Plus
AnxB11-PF 322 CG9968-PF 168..320 19..167 197 33.3 Plus
AnxB11-PC 322 CG9968-PC 168..320 19..167 197 33.3 Plus
AnxB11-PA 322 CG9968-PA 168..320 19..167 197 33.3 Plus
AnxB11-PG 511 CG9968-PG 357..509 19..167 197 33.3 Plus
AnxB11-PE 511 CG9968-PE 357..509 19..167 197 33.3 Plus
AnxB11-PB 511 CG9968-PB 357..509 19..167 197 33.3 Plus
AnxB11-PD 295 CG9968-PD 141..293 19..167 197 33.3 Plus
AnxB11-PF 322 CG9968-PF 87..316 23..247 196 28.9 Plus
AnxB11-PC 322 CG9968-PC 87..316 23..247 196 28.9 Plus
AnxB11-PA 322 CG9968-PA 87..316 23..247 196 28.9 Plus
AnxB11-PG 511 CG9968-PG 276..505 23..247 196 28.9 Plus
AnxB11-PE 511 CG9968-PE 276..505 23..247 196 28.9 Plus
AnxB11-PB 511 CG9968-PB 276..505 23..247 196 28.9 Plus
AnxB11-PD 295 CG9968-PD 60..289 23..247 196 29.3 Plus
AnxB10-PA 320 CG9579-PA 96..317 30..247 171 24.2 Plus
AnxB10-PA 320 CG9579-PA 167..317 17..163 171 27.8 Plus
AnxB10-PA 320 CG9579-PA 17..158 178..323 168 29.5 Plus
AnxB10-PB 321 CG9579-PB 17..158 178..323 168 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22446-PA 324 GI22446-PA 1..324 1..324 1538 92.3 Plus
Dmoj\GI14303-PA 505 GI14303-PA 189..498 12..321 908 56.8 Plus
Dmoj\GI11094-PA 320 GI11094-PA 3..316 9..321 718 45.5 Plus
Dmoj\GI14303-PA 505 GI14303-PA 200..341 178..323 195 31.5 Plus
Dmoj\GI14303-PA 505 GI14303-PA 351..503 19..167 185 32.7 Plus
Dmoj\GI14303-PA 505 GI14303-PA 270..499 23..247 175 28 Plus
Dmoj\GI11094-PA 320 GI11094-PA 17..158 178..323 166 28.8 Plus
Dmoj\GI11094-PA 320 GI11094-PA 96..317 30..247 161 26 Plus
Dmoj\GI11094-PA 320 GI11094-PA 188..319 37..165 152 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11940-PA 324 GL11940-PA 1..324 1..324 1592 95.7 Plus
Dper\GL15887-PA 512 GL15887-PA 196..505 12..321 888 55.2 Plus
Dper\GL12917-PA 335 GL12917-PA 3..331 9..321 689 44.7 Plus
Dper\GL15887-PA 512 GL15887-PA 203..348 171..323 207 33.3 Plus
Dper\GL12917-PA 335 GL12917-PA 17..158 178..323 183 32.2 Plus
Dper\GL15887-PA 512 GL15887-PA 358..510 19..167 180 32.7 Plus
Dper\GL15887-PA 512 GL15887-PA 275..506 21..247 177 28.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19090-PA 324 GA19090-PA 1..324 1..324 1592 95.7 Plus
Dpse\GA22156-PA 505 GA22156-PA 189..498 12..321 885 55.2 Plus
Dpse\AnnX-PA 320 GA22806-PA 3..316 9..321 727 46.8 Plus
Dpse\GA22156-PA 505 GA22156-PA 196..341 171..323 204 33.3 Plus
Dpse\AnnX-PA 320 GA22806-PA 17..158 178..323 183 32.2 Plus
Dpse\GA22156-PA 505 GA22156-PA 351..503 19..167 181 32.7 Plus
Dpse\GA22156-PA 505 GA22156-PA 268..499 21..247 177 28.8 Plus
Dpse\AnnX-PA 320 GA22806-PA 96..317 30..247 166 26.4 Plus
Dpse\AnnX-PA 320 GA22806-PA 167..319 17..165 159 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15061-PA 304 GM15061-PA 1..304 1..324 1522 91.7 Plus
Dsec\GM13401-PA 322 GM13401-PA 2..316 7..322 914 57 Plus
Dsec\GM22687-PA 320 GM22687-PA 3..316 9..321 712 45.9 Plus
Dsec\GM13401-PA 322 GM13401-PA 17..158 178..323 215 34.2 Plus
Dsec\GM13401-PA 322 GM13401-PA 157..320 11..167 189 31.1 Plus
Dsec\GM22687-PA 320 GM22687-PA 17..158 178..323 170 29.5 Plus
Dsec\GM22687-PA 320 GM22687-PA 167..317 17..163 152 28.3 Plus
Dsec\GM22687-PA 320 GM22687-PA 96..317 30..247 151 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19393-PA 341 GD19393-PA 1..324 1..324 1602 96.6 Plus
Dsim\GD15750-PA 322 GD15750-PA 2..316 7..322 914 57 Plus
Dsim\GD22929-PA 320 GD22929-PA 3..316 9..321 719 45.9 Plus
Dsim\GD15750-PA 322 GD15750-PA 17..158 178..323 210 33.6 Plus
Dsim\GD15750-PA 322 GD15750-PA 157..320 11..167 189 31.1 Plus
Dsim\GD22929-PA 320 GD22929-PA 17..158 178..323 170 29.5 Plus
Dsim\GD22929-PA 320 GD22929-PA 167..317 17..163 158 28.3 Plus
Dsim\GD22929-PA 320 GD22929-PA 96..317 30..247 156 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11008-PA 324 GJ11008-PA 1..324 1..324 1563 94.1 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 189..498 12..321 911 56.8 Plus
Dvir\GJ15779-PA 320 GJ15779-PA 3..316 9..321 722 47.1 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 196..341 171..323 198 32.7 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 351..503 19..167 182 32.7 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 270..499 23..247 180 29 Plus
Dvir\GJ15779-PA 320 GJ15779-PA 17..158 178..323 158 28.8 Plus
Dvir\GJ15779-PA 320 GJ15779-PA 188..319 37..165 153 27.8 Plus
Dvir\GJ15779-PA 320 GJ15779-PA 96..317 30..247 149 25.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14180-PA 324 GK14180-PA 1..324 1..324 1579 94.8 Plus
Dwil\GK25708-PA 672 GK25708-PA 356..665 12..321 920 57.4 Plus
Dwil\GK25596-PA 320 GK25596-PA 15..316 21..321 686 46 Plus
Dwil\GK25708-PA 672 GK25708-PA 363..508 171..323 206 32.7 Plus
Dwil\GK25708-PA 672 GK25708-PA 518..670 19..167 185 32.7 Plus
Dwil\GK25708-PA 672 GK25708-PA 437..666 23..247 180 28 Plus
Dwil\GK25596-PA 320 GK25596-PA 17..158 178..323 172 29.5 Plus
Dwil\GK25596-PA 320 GK25596-PA 96..317 30..247 162 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15970-PA 505 GE15970-PA 189..498 12..321 903 57.4 Plus
Dyak\GE15364-PA 320 GE15364-PA 3..316 9..321 713 45.9 Plus
Dyak\GE15970-PA 505 GE15970-PA 200..341 178..323 209 32.9 Plus
Dyak\GE15970-PA 505 GE15970-PA 351..503 19..167 185 33.3 Plus
Dyak\GE15970-PA 505 GE15970-PA 270..499 23..247 178 30.5 Plus
Dyak\GE15364-PA 320 GE15364-PA 20..158 181..323 172 30.1 Plus
Dyak\GE15364-PA 320 GE15364-PA 188..317 37..163 157 27.5 Plus
Dyak\GE15364-PA 320 GE15364-PA 96..317 30..247 150 24.7 Plus

LD09947.hyp Sequence

Translation from 81 to 1055

> LD09947.hyp
MSSAEYYPFKCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILAR
RGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQ
ELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGD
TSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTF
NSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCC
KSKIDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGK
SLESWIKDDLSGDYSYVLQCLASY*

LD09947.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-PB 324 CG5730-PB 1..324 1..324 1659 100 Plus
AnxB9-PD 324 CG5730-PD 1..324 1..324 1659 100 Plus
AnxB9-PF 324 CG5730-PF 1..324 1..324 1600 96.6 Plus
AnxB9-PE 324 CG5730-PE 1..324 1..324 1600 96.6 Plus
AnxB9-PC 324 CG5730-PC 1..324 1..324 1600 96.6 Plus