Clone LD10153 Report

Search the DGRC for LD10153

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:101
Well:53
Vector:pBS SK-
Associated Gene/TranscriptRad23-RA
Protein status:LD10153.pep: gold
Preliminary Size:1477
Sequenced Size:1479

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1836 2000-02-14 Blastp of sequenced clone
CG1836 2001-01-01 Release 2 assignment
CG1836 2003-01-01 Sim4 clustering to Release 3
Rad23 2008-04-29 Release 5.5 accounting
Rad23 2008-08-15 Release 5.9 accounting
Rad23 2008-12-18 5.12 accounting

Clone Sequence Records

LD10153.complete Sequence

1479 bp (1479 high quality bases) assembled on 2000-02-14

GenBank Submission: AF132147

> LD10153.complete
AAATCGTTTTTATCAAGCGATATTGGGAACTAACTTTCGAGTTTGCATAT
GTGTATGCATATGTATATTTAATTAAGTTTTGGTTTTGTCTGATACACAA
GATGATTATTACAATTAAAAATCTTCAACAGCAAACTTTTACTATTGAGT
TTGCCCCGGAAAAAACGGTTTTGGAACTGAAGAAGAAAATATTCGAGGAG
CGCGGTCCAGAGTACGTCGCCGAAAAACAAAAACTGATCTACGCTGGCGT
CATATTGACGGATGACCGCACCGTTGGTTCATACAACGTTGATGAAAAAA
AGTTCATTGTGGTAATGTTGACACGCGATTCGTCTAGTTCAAATCGTAAT
CAACTTAGTGTAAAAGAAAGTAATAAATTGACTAGCACCGACGATTCAAA
GCAATCTATGCCTTGCGAAGAAGCCAACCATACCAATTCGCCTAGTTCCA
CAAATACAGAAGATTCAGTTTTATCACGTGAAACCAGACCTTTATCTAGT
GACGAATTGATTGGCGAGTTGGCCCAGGCTTCCTTACAATCGCGCGCTGA
ATCTAATTTGCTTATGGGTGACGAATACAACCAAACAGTCCTATCAATGG
TGGAAATGGGTTACCCAAGAGAGCAGGTTGAACGTGCGATGGCTGCTAGT
TATAACAACCCGGAAAGAGCCGTTGAATATCTCATTAATGGCATACCTGC
AGAGGAAGGTACTTTTTACAATAGGCTGAATGAATCAACGAATCCTAGTC
TAATCCCCTCCGGACCGCAACCTGCGTCGGCAACCTCTGCCGAGCGTTCA
ACAGAATCAAATTCAGACCCCTTTGAATTTTTACGTAGCCAGCCACAGTT
TCTTCAAATGCGATCTTTAATTTATCAAAACCCTCATCTTTTGCATGCAG
TATTGCAGCAGATTGGTCAGACAAACCCAGCCCTTTTACAACTTATTTCG
GAGAACCAAGATGCGTTTCTCAATATGCTTAATCAACCGATTGACCGCGA
ATCGGAGTCAGGCGCCACCGTTCCTCCCGTTTCGAATGCGCGGATTCCTT
CAACTTTGGACAATGTTGACCTCTTTTCTCCAGATTTAGAAGTAGCTACT
TCAGCACAAAGATCAGCCGCGGGTACAAGTGCAGCACATCAAAGCGGTAG
CGCAGCGGATAACGAAGACTTGGAACAACCTTTAGGAGTATCAACCATTC
GTTTAAATCGCCAAGATAAGGACGCAATAGAACGGCTAAAAGCTCTTGGA
TTCCCAGAGGCCCTTGTACTGCAAGCGTACTTCGCTTGTGAAAAGAACGA
GGAACAAGCAGCTAATTTTTTGCTATCGTCTAGCTTCGATGATTAGGATG
ACAAAATGTAAGAAGTTATGCAAATAACACCGGAAGCGTTACATTTAAAG
TTAGATGTTCTTAAATTAAATGTAAAATGTCGATCATAAAAATTCTTTTA
TATTCTTTTAAAAAAAAAAAAAAAAAAAA

LD10153.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23.c 1633 Rad23.c 246..1544 163..1461 6480 99.9 Plus
Rad23-RB 1594 Rad23-RB 207..1505 163..1461 6480 99.9 Plus
Rad23.b 1597 Rad23.b 210..1508 163..1461 6480 99.9 Plus
Rad23.c 1633 Rad23.c 27..195 1..169 845 100 Plus
Rad23-RB 1594 Rad23-RB 27..194 1..168 840 100 Plus
Rad23.b 1597 Rad23.b 27..193 1..167 835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 328991..329644 163..816 3255 99.8 Plus
chr4 1351717 chr4 330257..330582 910..1235 1630 100 Plus
chr4 1351717 chr4 330643..330867 1235..1459 1125 100 Plus
chr4 1351717 chr4 328688..328856 1..169 845 100 Plus
chr4 1351717 chr4 330099..330198 812..911 500 100 Plus
chr4 1351717 chr4 326859..326913 87..141 215 92.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 308426..309079 163..816 3255 99.8 Plus
4 1348131 4 309692..310017 910..1235 1630 100 Plus
4 1348131 4 310078..310304 1235..1461 1135 100 Plus
4 1348131 4 308123..308291 1..169 845 100 Plus
4 1348131 4 309534..309633 812..911 500 100 Plus
4 1348131 4 306297..306351 87..141 215 92.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 308426..309079 163..816 3255 99.8 Plus
4 1331231 4 309692..310017 910..1235 1630 100 Plus
4 1331231 4 310078..310304 1235..1461 1135 100 Plus
4 1331231 4 308123..308291 1..169 845 100 Plus
4 1331231 4 309534..309633 812..911 500 100 Plus
4 1331231 4 306297..306351 87..141 215 92.7 Plus
Blast to na_te.dros performed 2019-03-16 16:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 5001..5082 84..7 113 62.2 Minus

LD10153.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:01:35 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 328688..328854 1..167 100 -> Plus
chr4 328996..329644 168..816 100 -> Plus
chr4 330104..330198 817..911 100 -> Plus
chr4 330259..330582 912..1235 100 -> Plus
chr4 330644..330867 1236..1459 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:29 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 1..1245 102..1346 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:35:41 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 1..1245 102..1346 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:25:17 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 1..1245 102..1346 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:11:34 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 1..1245 102..1346 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:34 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 1..1245 102..1346 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:38:43 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 17..1475 1..1459 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:35:41 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 17..1475 1..1459 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:25:17 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 31..1489 1..1459 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:11:34 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 17..1475 1..1459 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:34 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 31..1489 1..1459 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:35 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
4 310079..310302 1236..1459 100   Plus
4 308123..308289 1..167 100 -> Plus
4 308431..309079 168..816 100 -> Plus
4 309539..309633 817..911 100 -> Plus
4 309694..310017 912..1235 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:35 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
4 310079..310302 1236..1459 100   Plus
4 308123..308289 1..167 100 -> Plus
4 308431..309079 168..816 100 -> Plus
4 309539..309633 817..911 100 -> Plus
4 309694..310017 912..1235 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:35 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
4 310079..310302 1236..1459 100   Plus
4 308123..308289 1..167 100 -> Plus
4 308431..309079 168..816 100 -> Plus
4 309539..309633 817..911 100 -> Plus
4 309694..310017 912..1235 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:25:17 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 328749..328915 1..167 100 -> Plus
arm_4 329057..329705 168..816 100 -> Plus
arm_4 330165..330259 817..911 100 -> Plus
arm_4 330320..330643 912..1235 100 -> Plus
arm_4 330705..330928 1236..1459 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:48:01 Download gff for LD10153.complete
Subject Subject Range Query Range Percent Splice Strand
4 308431..309079 168..816 100 -> Plus
4 309539..309633 817..911 100 -> Plus
4 309694..310017 912..1235 100 -> Plus
4 310079..310302 1236..1459 100   Plus
4 308123..308289 1..167 100 -> Plus

LD10153.hyp Sequence

Translation from 2 to 1345

> LD10153.hyp
IVFIKRYWELTFEFAYVYAYVYLIKFWFCLIHKMIITIKNLQQQTFTIEF
APEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKK
FIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSST
NTEDSVLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMV
EMGYPREQVERAMAASYNNPERAVEYLINGIPAEEGTFYNRLNESTNPSL
IPSGPQPASATSAERSTESNSDPFEFLRSQPQFLQMRSLIYQNPHLLHAV
LQQIGQTNPALLQLISENQDAFLNMLNQPIDRESESGATVPPVSNARIPS
TLDNVDLFSPDLEVATSAQRSAAGTSAAHQSGSAADNEDLEQPLGVSTIR
LNRQDKDAIERLKALGFPEALVLQAYFACEKNEEQAANFLLSSSFDD*

LD10153.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-PC 414 CG1836-PC 1..414 34..447 2071 100 Plus
Rad23-PA 414 CG1836-PA 1..414 34..447 2071 100 Plus
Rad23-PB 343 CG1836-PB 1..343 105..447 1718 100 Plus
CG10694-PA 290 CG10694-PA 1..288 34..447 293 24.9 Plus

LD10153.pep Sequence

Translation from 101 to 1345

> LD10153.pep
MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGV
ILTDDRTVGSYNVDEKKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSK
QSMPCEEANHTNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAE
SNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGIPA
EEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDPFEFLRSQPQF
LQMRSLIYQNPHLLHAVLQQIGQTNPALLQLISENQDAFLNMLNQPIDRE
SESGATVPPVSNARIPSTLDNVDLFSPDLEVATSAQRSAAGTSAAHQSGS
AADNEDLEQPLGVSTIRLNRQDKDAIERLKALGFPEALVLQAYFACEKNE
EQAANFLLSSSFDD*

LD10153.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19257-PA 405 GF19257-PA 1..405 1..414 1300 64.8 Plus
Dana\GF23005-PA 318 GF23005-PA 1..317 1..414 346 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16385-PA 414 GG16385-PA 1..414 1..414 1818 85.8 Plus
Dere\GG11252-PA 297 GG11252-PA 1..294 1..414 287 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23932-PA 470 GH23932-PA 1..470 1..414 862 46.8 Plus
Dgri\GH18491-PA 282 GH18491-PA 111..229 161..296 224 38.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-PC 414 CG1836-PC 1..414 1..414 2071 100 Plus
Rad23-PA 414 CG1836-PA 1..414 1..414 2071 100 Plus
Rad23-PB 343 CG1836-PB 1..343 72..414 1718 100 Plus
CG10694-PA 290 CG10694-PA 1..288 1..414 293 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14087-PA 442 GI14087-PA 1..442 1..414 1141 56.7 Plus
Dmoj\GI24165-PA 299 GI24165-PA 1..245 1..297 302 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18167-PA 430 GL18167-PA 1..430 1..414 1276 62.9 Plus
Dper\GL23402-PA 314 GL23402-PA 1..313 1..414 281 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14903-PA 430 GA14903-PA 1..430 1..414 1276 62.9 Plus
Dpse\GA10501-PA 313 GA10501-PA 1..312 1..414 285 26.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26792-PA 414 GM26792-PA 1..414 1..414 2024 93.7 Plus
Dsec\GM26556-PA 288 GM26556-PA 1..286 1..414 275 24.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Rad23-PA 110 GD24402-PA 1..101 1..101 475 91.1 Plus
Dsim\GD21063-PA 288 GD21063-PA 1..286 1..414 278 24.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16257-PA 448 GJ16257-PA 1..448 1..414 1172 57.5 Plus
Dvir\GJ14198-PA 290 GJ14198-PA 112..282 161..408 270 29.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13711-PA 420 GK13711-PA 1..420 1..414 1172 61.6 Plus
Dwil\GK11154-PA 284 GK11154-PA 1..214 1..282 206 29.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14546-PA 411 GE14546-PA 1..411 1..414 1813 86.3 Plus
Dyak\GE23445-PA 297 GE23445-PA 1..294 1..414 268 24.6 Plus