Clone LD10220 Report

Search the DGRC for LD10220

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:102
Well:20
Vector:pBS SK-
Associated Gene/TranscriptCG9205-RA
Protein status:LD10220.pep: gold
Preliminary Size:1331
Sequenced Size:1136

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9205 2001-01-01 Release 2 assignment
CG9205 2001-10-10 Blastp of sequenced clone
CG9205 2003-01-01 Sim4 clustering to Release 3
CG9205 2008-04-29 Release 5.5 accounting
CG9205 2008-08-15 Release 5.9 accounting
trio 2008-08-15 Release 5.9 accounting
CG9205 2008-12-18 5.12 accounting
trio 2008-12-18 5.12 accounting

Clone Sequence Records

LD10220.complete Sequence

1136 bp (1136 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061117

> LD10220.complete
ATTTTTTTCACTCGCGCTGCTTTTGTTTTTCACACGCTTTCCCACCGGTA
AAATCACCCAAGTTACCGTTGCACGCAGTTCGCGACTTGACGCGGGCTAA
GCTAAAATTTTCATTTTTCAAGAAACCGCGATTTTACGAACGGGCGCTCT
CTGTTTTGTTTAAACAAATTGGATTTTGCGAAACGACAACTTCCGTTTCT
GCCGAGTTTTACCAAATAAACCCGAATCAAATTAATATACCTGCAAACAT
TTTACGCAAAATCAAGAACTCGCTTCGCCAGCGCAAGAAGAAGCACCGCC
CACGGCAGGCCACGCCCCCAGTGCGCCCCGATCCCAAGGACGCCGCCGCC
AAAATGGAGAGCAACTTGAACAGGATCATTCGTGAATCGGCCAAACTGAA
ACTCTGCGGTCAGCTCAGCAAATACACCAATGTGATGAAGGGATGGCAGT
ACCGTTGGTTTACGGTGGACGCCAAGACAGGATCGCTGAGCTACTACCTG
TGCGACTCGTCGACGGTGGGCGACGACATCGCGCCCTCGCCCCACGTCCT
GGCCAGTGCTCCCAGGGGCCAGGTGCAGCTGGCCGGCGCAGTGGTGTACC
CGAGTGACGAGGACTCTAGGACGTTCGCCATCGCCTGCGCCTCCGGCGAT
ACGGTAAAGCTGAGGGCCAACGATGCCAGGGCCCGTCAGGAGTGGGTGGA
TGGCCTGCGGGCGGTGGTCGAGAGTCACATGAAGGCGATGGACATCAGCA
ACTCGTCGCCGCTTCCTCCGCGGGAATTGCTTGCCGCCTCCGATGCCATG
GTTTCAGCGCGCCAAGCTCTGTTTCTCACGGAACAATGCAACGCTTCTCT
GGCCAGGGCCATCGAGAGCATCGACTGCGCTTCCTTCTCGCCAACGGATC
CCGATCTTCTTTTGCTCAAGGCGATCTCCACGGCCAGCACCCAGTGCCTG
CACCAGTGCTTGGGATTACTGCAACGCCACCAGGAGATCAACCAGCCGGT
GGCAGAGGCCGTGCCTCTTGTGCTTTGAGAGATGCATGCTGCAAGGATAG
TCTCCAGTTTCCAGTTTCCACTAAGATATGCCCAATAAACACTAAGCCAA
ACCGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD10220.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9205-RA 1105 CG9205-RA 1..1105 1..1105 5525 100 Plus
CG9205-RB 1196 CG9205-RB 103..1020 190..1107 4590 100 Plus
CG9205.a 908 CG9205.a 69..908 266..1105 4200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1035186..1035583 441..838 1915 98.7 Plus
chr3L 24539361 chr3L 1035660..1035925 840..1105 1270 98.5 Plus
chr3L 24539361 chr3L 1034837..1035089 190..442 1205 98.4 Plus
chr3L 24539361 chr3L 1034323..1034511 1..189 915 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1035559..1035956 441..838 1990 100 Plus
3L 28110227 3L 1036031..1036300 838..1107 1350 100 Plus
3L 28110227 3L 1035210..1035462 190..442 1265 100 Plus
3L 28110227 3L 1034697..1034885 1..189 945 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1035559..1035956 441..838 1990 100 Plus
3L 28103327 3L 1036031..1036300 838..1107 1350 100 Plus
3L 28103327 3L 1035210..1035462 190..442 1265 100 Plus
3L 28103327 3L 1034697..1034885 1..189 945 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:01:02 has no hits.

LD10220.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:01:41 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1034323..1034511 1..189 98 -> Plus
chr3L 1034837..1035088 190..441 98 -> Plus
chr3L 1035187..1035583 442..838 98 -> Plus
chr3L 1035659..1035925 839..1105 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:32 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RB 1..675 354..1028 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:46 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RB 1..675 354..1028 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:25:37 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..675 354..1028 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:34 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RB 1..675 354..1028 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:52 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..675 354..1028 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:12 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:46 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:25:37 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:35 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:52 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9205-RA 1..1105 1..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:41 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1034697..1034885 1..189 100 -> Plus
3L 1035210..1035461 190..441 100 -> Plus
3L 1035560..1035956 442..838 100 -> Plus
3L 1036032..1036298 839..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:41 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1034697..1034885 1..189 100 -> Plus
3L 1035210..1035461 190..441 100 -> Plus
3L 1035560..1035956 442..838 100 -> Plus
3L 1036032..1036298 839..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:41 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1034697..1034885 1..189 100 -> Plus
3L 1035210..1035461 190..441 100 -> Plus
3L 1035560..1035956 442..838 100 -> Plus
3L 1036032..1036298 839..1105 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:25:37 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1034697..1034885 1..189 100 -> Plus
arm_3L 1035210..1035461 190..441 100 -> Plus
arm_3L 1035560..1035956 442..838 100 -> Plus
arm_3L 1036032..1036298 839..1105 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:29 Download gff for LD10220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1035210..1035461 190..441 100 -> Plus
3L 1035560..1035956 442..838 100 -> Plus
3L 1036032..1036298 839..1105 100   Plus
3L 1034697..1034885 1..189 100 -> Plus

LD10220.hyp Sequence

Translation from 2 to 1027

> LD10220.hyp
FFHSRCFCFSHAFPPVKSPKLPLHAVRDLTRAKLKFSFFKKPRFYERALS
VLFKQIGFCETTTSVSAEFYQINPNQINIPANILRKIKNSLRQRKKKHRP
RQATPPVRPDPKDAAAKMESNLNRIIRESAKLKLCGQLSKYTNVMKGWQY
RWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP
SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISN
SSPLPPRELLAASDAMVSARQALFLTEQCNASLARAIESIDCASFSPTDP
DLLLLKAISTASTQCLHQCLGLLQRHQEINQPVAEAVPLVL*

LD10220.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG9205-PB 224 CG9205-PB 1..224 118..341 1142 100 Plus
CG9205-PA 224 CG9205-PA 1..224 118..341 1142 100 Plus
CG1513-PA 784 CG1513-PA 26..120 136..242 156 34.6 Plus

LD10220.pep Sequence

Translation from 353 to 1027

> LD10220.pep
MESNLNRIIRESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLC
DSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYPSDEDSRTFAIACASGDT
VKLRANDARARQEWVDGLRAVVESHMKAMDISNSSPLPPRELLAASDAMV
SARQALFLTEQCNASLARAIESIDCASFSPTDPDLLLLKAISTASTQCLH
QCLGLLQRHQEINQPVAEAVPLVL*

LD10220.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24427-PA 224 GF24427-PA 1..224 1..224 1139 95.5 Plus
Dana\GF11570-PA 748 GF11570-PA 20..116 17..125 161 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14753-PA 224 GG14753-PA 1..224 1..224 1186 100 Plus
Dere\GG25251-PA 778 GG25251-PA 24..120 17..125 164 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15820-PA 229 GH15820-PA 1..221 1..221 1053 89.1 Plus
Dgri\GH19816-PA 759 GH19816-PA 9..105 17..125 167 34.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9205-PB 224 CG9205-PB 1..224 1..224 1142 100 Plus
CG9205-PA 224 CG9205-PA 1..224 1..224 1142 100 Plus
CG1513-PA 784 CG1513-PA 26..120 19..125 156 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12601-PA 306 GI12601-PA 77..296 1..220 1051 89.1 Plus
Dmoj\GI20405-PA 751 GI20405-PA 9..105 17..125 166 35.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16677-PA 268 GL16677-PA 47..268 1..222 1087 91 Plus
Dper\GL17708-PA 510 GL17708-PA 28..124 17..125 168 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21611-PA 222 GA21611-PA 1..222 1..222 1082 91 Plus
Dpse\GA13517-PB 776 GA13517-PB 28..124 17..125 169 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14372-PA 224 GM14372-PA 1..224 1..224 1186 100 Plus
Dsec\GM20569-PA 686 GM20569-PA 24..120 17..125 164 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13589-PA 222 GD13589-PA 1..222 1..224 1163 99.1 Plus
Dsim\GD10040-PA 218 GD10040-PA 24..120 17..125 164 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12724-PA 229 GJ12724-PA 1..221 1..221 1062 90 Plus
Dvir\GJ20077-PA 778 GJ20077-PA 9..105 17..125 166 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17329-PA 228 GK17329-PA 3..223 5..222 1034 87.8 Plus
Dwil\GK21855-PA 269 GK21855-PA 26..122 17..125 170 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21116-PA 224 GE21116-PA 1..224 1..224 1184 99.6 Plus
Dyak\GE21951-PA 782 GE21951-PA 24..120 17..125 165 34.9 Plus