Clone LD10274 Report

Search the DGRC for LD10274

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:102
Well:74
Vector:pBS SK-
Associated Gene/Transcriptthoc7-RA
Protein status:LD10274.pep: validated full length
Preliminary Size:1055
Sequenced Size:876

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17143 2001-01-01 Release 2 assignment
CG17143 2003-01-01 Sim4 clustering to Release 3
CG17143 2003-02-27 Blastp of sequenced clone
thoc7 2008-04-29 Release 5.5 accounting
thoc7 2008-08-15 Release 5.9 accounting
thoc7 2008-12-18 5.12 accounting

Clone Sequence Records

LD10274.complete Sequence

876 bp (876 high quality bases) assembled on 2003-02-27

GenBank Submission: BT010075

> LD10274.complete
AAGAAATCATAAAGCAGCGCCTGCTGATTGACGGGGATGGAACTGGAGAG
GATCGGAGAATAGTAGTGTTGCTGAAACAGTTCTTGAAGTGGGCCAGTGA
CTCGCTGGACAGCAATCCCATCATGTACGACCGACTGATGGCCCAATTCG
CCCAGTGCAAGCTCACTGCGTTAAAGAATGTACAAACTCTGCAGATGATC
GCCGGTGAGCGTGACAACTACACACAACTAGTTGAACACCACGAAGAAAG
TATTGTTTTGGCTAAAGCGGAAATCGAATCCAGTAAAAAAGAGCTAATCA
CTGCCAAGCAGATTCGCAAGAACAAGATGGAGTACGACCTGCTGGCCTCG
CTCATCCAGGACCAACCGGACCGCAGTGAAACACAGCGACATATTGAGAC
CATTAGGAGGGAGATTGACGACTTGGTGCAAAAGAAGCTAAAGATGGAGC
GCAAGTTTCAGAAACGACGCAATGACTTCACTTTGCTGATGTACACGATT
CACGAGCTGGAACAGCAGCTGGACCAGGACAGCTCATCCTCGGCATCCTC
CTCGTCCAGCGATTGCGATGCCCGCTCTGAGCCGGACCTAGACGACAATG
GGATCATGGAGGTAAGCGATGAAGACGACGATCTCAACAATAGCACTCCC
ACAAAGTTCGACGGAGCCCGCGGCGAGCCCAAATATCACTCAGTCTCTAC
TGAGGACTCTAAAGCCATGTCCGTAGAAGAGGACACGGTGCTTGAGCTAA
GCATCGACAAAGATGAGCACGACGTGGATGTAGCTGTTGCCAATTAGGTT
AGAAGCGCTAGCATGTACAATAAAAACAAAAAAATAAAATGTCATGAACT
ATAATATACAAAAAAAAAAAAAAAAA

LD10274.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
thoc7-RA 942 thoc7-RA 84..942 1..859 4295 100 Plus
thoc7.a 1017 thoc7.a 159..1017 1..859 4295 100 Plus
thoc7-RB 926 thoc7-RB 70..926 3..859 4285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 211591..212334 859..116 3720 100 Minus
chr3L 24539361 chr3L 212400..212514 115..1 575 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 211633..212379 862..116 3735 100 Minus
3L 28110227 3L 212445..212559 115..1 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 211633..212379 862..116 3735 100 Minus
3L 28103327 3L 212445..212559 115..1 575 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:48:53 has no hits.

LD10274.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:49:35 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 211591..212334 116..859 100 <- Minus
chr3L 212400..212514 1..115 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:37 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..867 1..797 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:32 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..867 1..797 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:33 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..867 1..797 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:55 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..867 1..797 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:42:53 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..867 1..797 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:29 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..929 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:32 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..929 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:33 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..929 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:55 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..929 1..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:42:53 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
thoc7-RA 71..929 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:35 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 211636..212379 116..859 100 <- Minus
3L 212445..212559 1..115 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:35 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 211636..212379 116..859 100 <- Minus
3L 212445..212559 1..115 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:35 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 211636..212379 116..859 100 <- Minus
3L 212445..212559 1..115 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:33 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 211636..212379 116..859 100 <- Minus
arm_3L 212445..212559 1..115 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:14 Download gff for LD10274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 211636..212379 116..859 100 <- Minus
3L 212445..212559 1..115 100   Minus

LD10274.hyp Sequence

Translation from 2 to 796

> LD10274.hyp
EIIKQRLLIDGDGTGEDRRIVVLLKQFLKWASDSLDSNPIMYDRLMAQFA
QCKLTALKNVQTLQMIAGERDNYTQLVEHHEESIVLAKAEIESSKKELIT
AKQIRKNKMEYDLLASLIQDQPDRSETQRHIETIRREIDDLVQKKLKMER
KFQKRRNDFTLLMYTIHELEQQLDQDSSSSASSSSSDCDARSEPDLDDNG
IMEVSDEDDDLNNSTPTKFDGARGEPKYHSVSTEDSKAMSVEEDTVLELS
IDKDEHDVDVAVAN*

LD10274.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
thoc7-PB 287 CG17143-PB 24..287 1..264 1328 100 Plus
thoc7-PA 288 CG17143-PA 25..288 1..264 1328 100 Plus

LD10274.pep Sequence

Translation from 122 to 796

> LD10274.pep
MYDRLMAQFAQCKLTALKNVQTLQMIAGERDNYTQLVEHHEESIVLAKAE
IESSKKELITAKQIRKNKMEYDLLASLIQDQPDRSETQRHIETIRREIDD
LVQKKLKMERKFQKRRNDFTLLMYTIHELEQQLDQDSSSSASSSSSDCDA
RSEPDLDDNGIMEVSDEDDDLNNSTPTKFDGARGEPKYHSVSTEDSKAMS
VEEDTVLELSIDKDEHDVDVAVAN*

LD10274.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10568-PA 272 GF10568-PA 48..271 1..223 936 87.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14678-PA 288 GG14678-PA 64..288 1..224 1073 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15660-PA 279 GH15660-PA 48..278 1..223 652 65.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
thoc7-PB 287 CG17143-PB 64..287 1..224 1127 100 Plus
thoc7-PA 288 CG17143-PA 65..288 1..224 1127 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12705-PA 273 GI12705-PA 48..272 1..223 681 68.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16104-PA 274 GL16104-PA 48..273 1..223 897 83.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14344-PA 274 GA14344-PA 48..273 1..223 897 83.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14294-PA 289 GM14294-PA 65..289 1..224 1145 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13532-PA 289 GD13532-PA 65..289 1..224 1145 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12688-PA 276 GJ12688-PA 48..275 1..223 699 69.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16853-PA 277 GK16853-PA 48..276 1..223 659 61.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21039-PA 289 GE21039-PA 65..289 1..224 1075 95.1 Plus