Clone LD10431 Report

Search the DGRC for LD10431

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:104
Well:31
Vector:pBS SK-
Associated Gene/TranscriptBaldspot-RA
Protein status:LD10431.pep: gold
Preliminary Size:1503
Sequenced Size:1390

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3971 2001-10-10 Blastp of sequenced clone
Baldspot 2008-04-29 Release 5.5 accounting
Baldspot 2008-08-15 Release 5.9 accounting
Baldspot 2008-12-18 5.12 accounting

Clone Sequence Records

LD10431.complete Sequence

1390 bp (1390 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061121

> LD10431.complete
CGAACCGCCAGCTAAACGTTCAGTTCGCTTTGCGCCGGCAAATTCGATAG
TTTTTTGAGTTTGCTGAACCGAGTCGCTGGGGCAGAAGTGTGTGACAGCC
AGCCGTGTGTGTTGTGATCCAGCCAATTGATACTGCGATAAGAGGCGGCG
AGCAAATCTGCATATAACCCAAGTAACATAGCCACCAACTCAAACACATA
AAGCCCACCAAAATGATCAACATGGACATTAGCGTTACGCCCAATTACTC
GTACATCTTCGACTTCGAGAACGATTTCATACACCAGCGGACGCGCAAAT
GGATGCTAGAGAACTGGACATGGGTGTTCTACTACTGCGGCATCTACATG
CTGGTCATCTTCGGTGGTCAGCACTTTATGCAAAATCGGCCTAGATTCCA
ATTGCGCGGCCCGCTGATCATATGGAACACCTTGCTGGCCATGTTCAGCA
TCATGGGTGCTGCCCGAACGGCGCCGGAGCTGATTCACGTGCTGCGTCAC
TACGGACTCTTCCACTCCGTCTGCGTGCCCAGCTACATCGAGCAAGATCG
CGTGTGCGGCTTCTGGACCTGGCTCTTCGTGCTCAGCAAACTGCCGGAGC
TGGGCGACACGATATTCATTGTGCTCCGCAAGCAGCCACTCATCTTTTTG
CACTGGTATCACCACATCACCGTGCTGATCTACTCGTGGTTCAGCTATAC
GGAATATACCAGCTCTGCCCGCTGGTTCATCGTGATGAACTACTGCGTGC
ACTCGGTGATGTACAGCTACTATGCTCTGAAGGCGGCCCGCTTCAATCCG
CCCAGGTTCATCTCGATGATCATCACGTCGCTGCAGCTGGCTCAGATGAT
CATCGGATGTGCGATCAACGTGTGGGCCAATGGCTTCCTGAAGACGCACG
GCACCTCCTCCTGTCACATCTCGCAGCGCAACATCAATCTGTCGATCGCC
ATGTACTCCAGCTACTTTGTCCTGTTCGCGCGCTTCTTCTACAAGGCGTA
CCTGGCGCCCGGTGGTCACAAGAGCCGGCGCATGGCCGCCTCCCTGGCAG
CCCAGAATGTGGTCAAGCAGTCGAGCAGCCCCCAGCAGGCCAGCGAGAGC
TCCAAGTTCATCGGCGCTGGCGAGGATCAGGCAGCCTATCTGCGCAAGGC
CAAGGCGCAGTAAAACGGAGCTCGGCACACCAGCACCTAACTCCCATCAT
CACCACTCCCCCTGTTTACGGCTAAGGACCTTTATTTATGTAGCGGTGTA
CAAGTTGTTTTTTAATTTTAAACCTGGGTGGCACACGACCGGTCGGATGA
GAGTTTAATTTTGTAAGCCAAAAGTTGTACCGTGTGGACAGGCGTACGAA
CCATATATCTGAACATGTATATAAAAAAAAAAAAAAAAAA

LD10431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Baldspot-RA 2460 Baldspot-RA 43..1429 1..1387 6905 99.8 Plus
Baldspot.h 2852 Baldspot.h 220..1450 157..1387 6125 99.8 Plus
Baldspot-RB 2520 Baldspot-RB 259..1489 157..1387 6125 99.8 Plus
Baldspot.h 2852 Baldspot.h 4..160 1..157 785 100 Plus
Baldspot-RB 2520 Baldspot-RB 43..199 1..157 785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16639583..16640304 1372..651 3535 99.3 Minus
chr3L 24539361 chr3L 16648954..16649190 394..158 1185 100 Minus
chr3L 24539361 chr3L 16651217..16651373 157..1 785 100 Minus
chr3L 24539361 chr3L 16641115..16641254 532..393 700 100 Minus
chr3L 24539361 chr3L 16640847..16640975 658..530 645 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:57:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16649851..16650587 1387..651 3640 99.6 Minus
3L 28110227 3L 16659230..16659466 394..158 1185 100 Minus
3L 28110227 3L 16661471..16661627 157..1 785 100 Minus
3L 28110227 3L 16651398..16651537 532..393 700 100 Minus
3L 28110227 3L 16651130..16651258 658..530 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16642951..16643687 1387..651 3640 99.5 Minus
3L 28103327 3L 16652330..16652566 394..158 1185 100 Minus
3L 28103327 3L 16654571..16654727 157..1 785 100 Minus
3L 28103327 3L 16644498..16644637 532..393 700 100 Minus
3L 28103327 3L 16644230..16644358 658..530 645 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:39:12 has no hits.

LD10431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:40:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16651217..16651373 1..157 100   Minus
chr3L 16639583..16640299 656..1372 99 <- Minus
chr3L 16640850..16640972 533..655 100 <- Minus
chr3L 16641115..16641252 395..532 100 <- Minus
chr3L 16648954..16649190 158..394 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:37:21 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RB 1..951 213..1163 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:40:29 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RB 1..951 213..1163 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:04:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..951 213..1163 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:09:31 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RB 1..951 213..1163 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:27:49 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..951 213..1163 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:37:20 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..1372 1..1372 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:40:29 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..1372 1..1372 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:04:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..1360 13..1372 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:09:31 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..1372 1..1372 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:27:49 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
Baldspot-RA 1..1360 13..1372 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:40:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16649866..16650582 656..1372 100 <- Minus
3L 16651133..16651255 533..655 100 <- Minus
3L 16651398..16651535 395..532 100 <- Minus
3L 16659230..16659466 158..394 100 <- Minus
3L 16661471..16661627 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:40:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16649866..16650582 656..1372 100 <- Minus
3L 16651133..16651255 533..655 100 <- Minus
3L 16651398..16651535 395..532 100 <- Minus
3L 16659230..16659466 158..394 100 <- Minus
3L 16661471..16661627 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:40:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16649866..16650582 656..1372 100 <- Minus
3L 16651133..16651255 533..655 100 <- Minus
3L 16651398..16651535 395..532 100 <- Minus
3L 16659230..16659466 158..394 100 <- Minus
3L 16661471..16661627 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:04:07 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16642966..16643682 656..1372 100 <- Minus
arm_3L 16644233..16644355 533..655 100 <- Minus
arm_3L 16644498..16644635 395..532 100 <- Minus
arm_3L 16652330..16652566 158..394 100 <- Minus
arm_3L 16654571..16654727 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:45:37 Download gff for LD10431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16652330..16652566 158..394 100 <- Minus
3L 16654571..16654727 1..157 100   Minus
3L 16642966..16643682 656..1372 100 <- Minus
3L 16644233..16644355 533..655 100 <- Minus
3L 16644498..16644635 395..532 100 <- Minus

LD10431.pep Sequence

Translation from 212 to 1162

> LD10431.pep
MINMDISVTPNYSYIFDFENDFIHQRTRKWMLENWTWVFYYCGIYMLVIF
GGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLF
HSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQPLIFLHWYH
HITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFI
SMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSS
YFVLFARFFYKAYLAPGGHKSRRMAASLAAQNVVKQSSSPQQASESSKFI
GAGEDQAAYLRKAKAQ*

LD10431.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10511-PA 319 GF10511-PA 1..319 1..316 1606 94.7 Plus
Dana\GF13758-PA 261 GF13758-PA 31..259 45..272 169 26.6 Plus
Dana\GF15498-PA 253 GF15498-PA 20..252 39..273 168 27.3 Plus
Dana\GF15499-PA 244 GF15499-PA 14..242 43..273 164 26.3 Plus
Dana\GF18859-PA 332 GF18859-PA 49..332 19..303 161 25.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15860-PA 316 GG15860-PA 1..316 1..316 1696 99.7 Plus
Dere\GG13940-PA 268 GG13940-PA 10..258 9..263 170 28.3 Plus
Dere\GG20949-PA 262 GG20949-PA 35..255 45..264 169 27.8 Plus
Dere\GG17214-PA 265 GG17214-PA 32..265 43..277 158 24.1 Plus
Dere\GG12507-PA 277 GG12507-PA 26..219 26..214 157 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16451-PA 314 GH16451-PA 1..314 1..316 1550 92.1 Plus
Dgri\GH16129-PA 268 GH16129-PA 52..263 55..270 194 30.5 Plus
Dgri\GH18330-PA 323 GH18330-PA 50..290 52..301 168 25.4 Plus
Dgri\GH18331-PA 339 GH18331-PA 51..304 19..273 164 27.1 Plus
Dgri\GH17398-PA 285 GH17398-PA 1..219 4..214 156 26.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Baldspot-PB 316 CG3971-PB 1..316 1..316 1696 100 Plus
Baldspot-PA 316 CG3971-PA 1..316 1..316 1696 100 Plus
bond-PC 322 CG6921-PC 50..309 52..310 204 25.5 Plus
bond-PA 322 CG6921-PA 50..309 52..310 204 25.5 Plus
bond-PB 322 CG6921-PB 50..309 52..310 204 25.5 Plus
Elo68beta-PB 269 CG11801-PB 11..259 9..263 201 27.9 Plus
CG33110-PA 337 CG33110-PA 33..336 8..315 188 25.6 Plus
CG5326-PA 277 CG5326-PA 26..219 26..214 182 28 Plus
CG31141-PA 253 CG31141-PA 31..248 45..266 178 26.6 Plus
sit-PA 295 CG5278-PA 18..256 21..263 168 26.4 Plus
CG8534-PA 265 CG8534-PA 33..255 44..267 164 26.7 Plus
CG18609-PA 263 CG18609-PA 22..253 35..266 154 24.7 Plus
CG17821-PA 262 CG17821-PA 35..255 45..264 153 24.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16709-PA 318 GI16709-PA 1..318 1..316 1564 91.8 Plus
Dmoj\GI10223-PA 260 GI10223-PA 31..258 45..273 181 26.8 Plus
Dmoj\GI12398-PA 258 GI12398-PA 51..254 56..263 180 31.9 Plus
Dmoj\GI20345-PA 249 GI20345-PA 29..249 52..272 175 27 Plus
Dmoj\GI23311-PA 350 GI23311-PA 49..292 19..263 165 28.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12717-PA 334 GL12717-PA 1..334 1..316 1516 84.9 Plus
Dper\GL24915-PA 271 GL24915-PA 16..262 13..263 169 28.4 Plus
Dper\GL23223-PA 262 GL23223-PA 29..261 43..275 157 28.3 Plus
Dper\GL13810-PA 337 GL13810-PA 49..320 19..297 156 26.2 Plus
Dper\GL23222-PA 264 GL23222-PA 33..261 46..273 154 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17812-PA 312 GA17812-PA 1..312 1..316 1546 90.8 Plus
Dpse\GA23552-PA 271 GA23552-PA 16..262 13..263 169 28.4 Plus
Dpse\GA21802-PA 264 GA21802-PA 33..261 46..273 157 26.1 Plus
Dpse\GA26807-PA 337 GA26807-PA 49..320 19..297 156 26.2 Plus
Dpse\GA18806-PA 277 GA18806-PA 26..219 26..214 149 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24378-PA 316 GM24378-PA 1..316 1..316 1693 99.4 Plus
Dsec\GM23846-PA 258 GM23846-PA 15..256 33..275 166 27.4 Plus
Dsec\GM24776-PA 268 GM24776-PA 11..259 9..263 161 27.9 Plus
Dsec\GM23845-PA 265 GM23845-PA 31..265 42..277 157 26.2 Plus
Dsec\GM23639-PA 277 GM23639-PA 26..219 26..214 155 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12451-PA 267 GD12451-PA 13..267 62..316 1353 99.6 Plus
Dsim\GD18654-PA 263 GD18654-PA 15..258 33..275 163 26.3 Plus
Dsim\GD18449-PA 277 GD18449-PA 26..219 26..214 155 27.8 Plus
Dsim\GD18652-PA 265 GD18652-PA 31..265 42..277 153 26.2 Plus
Dsim\GD21043-PA 253 GD21043-PA 34..253 47..271 150 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12451-PA 319 GJ12451-PA 1..319 1..316 1567 91.5 Plus
Dvir\GJ24166-PA 327 GJ24166-PA 50..289 52..289 176 25.9 Plus
Dvir\GJ12287-PA 261 GJ12287-PA 49..253 55..263 169 31.1 Plus
Dvir\GJ11026-PA 263 GJ11026-PA 31..256 45..270 158 26.6 Plus
Dvir\GJ24167-PA 343 GJ24167-PA 49..292 19..263 157 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25673-PA 316 GK25673-PA 1..316 1..316 1582 93.1 Plus
Dwil\GK20708-PA 255 GK20708-PA 28..250 42..264 171 29.4 Plus
Dwil\GK12818-PA 327 GK12818-PA 47..319 19..296 166 26.9 Plus
Dwil\GK12817-PA 322 GK12817-PA 50..279 52..294 164 25.2 Plus
Dwil\GK12306-PA 226 GK12306-PA 19..216 21..214 161 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22199-PA 316 GE22199-PA 1..316 1..316 1696 99.7 Plus
Dyak\GE20239-PA 268 GE20239-PA 10..263 9..268 184 29.1 Plus
Dyak\GE10400-PA 253 GE10400-PA 30..253 44..271 157 26.8 Plus
Dyak\GE24724-PA 262 GE24724-PA 22..258 35..272 156 27.9 Plus
Dyak\GE13887-PA 262 GE13887-PA 35..255 45..264 155 27.4 Plus

LD10431.hyp Sequence

Translation from 212 to 1162

> LD10431.hyp
MINMDISVTPNYSYIFDFENDFIHQRTRKWMLENWTWVFYYCGIYMLVIF
GGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLF
HSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQPLIFLHWYH
HITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFI
SMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSS
YFVLFARFFYKAYLAPGGHKSRRMAASLAAQNVVKQSSSPQQASESSKFI
GAGEDQAAYLRKAKAQ*

LD10431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Baldspot-PB 316 CG3971-PB 1..316 1..316 1696 100 Plus
Baldspot-PA 316 CG3971-PA 1..316 1..316 1696 100 Plus
bond-PC 322 CG6921-PC 50..309 52..310 204 25.5 Plus
bond-PA 322 CG6921-PA 50..309 52..310 204 25.5 Plus
bond-PB 322 CG6921-PB 50..309 52..310 204 25.5 Plus