Clone LD10457 Report

Search the DGRC for LD10457

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:104
Well:57
Vector:pBS SK-
Associated Gene/TranscriptSsRbeta-RA
Protein status:LD10457.pep: gold
Preliminary Size:1139
Sequenced Size:949

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5474 2001-01-01 Release 2 assignment
CG5474 2002-11-12 Blastp of sequenced clone
CG5474 2003-01-01 Sim4 clustering to Release 3
SsRbeta 2008-04-29 Release 5.5 accounting
SsRbeta 2008-08-15 Release 5.9 accounting
SsRbeta 2008-12-18 5.12 accounting

Clone Sequence Records

LD10457.complete Sequence

949 bp (949 high quality bases) assembled on 2002-11-12

GenBank Submission: AF160923

> LD10457.complete
AGAAAGCGGCTGCCTGCTACGACTGCTGCTTAGTTGTACTGAAATACTCG
ATAAGGAAATACCCAAATTACAAAATGTTCAAGCACCTGCTGACTTTGTT
CGCCCTGTGCGCGGTGTTTAGCACCTGCCTGTCGGAAGACGAGACCCGTG
CCCGTCTCCTGGTCTCTAAGCAGATCCTGAACAAGTACCTGGTGGAGAAG
AGCGACCTGTTGGTACGCTACACCATCTTCAACGTGGGCAGCGGTGCCGC
CACCAAGGTGCGATTGGTAGACTCCGGCTTCCACCCGGAGGCCTTCGACG
TTGTCGGAGGACAGCCCACCGCCGTGGTCGATAGGATCGCTCCCCAGACC
AACTTCACCCATGTCCTGGTGGTGAGGCCCAAGGCCTTCGGCTACTTCAA
CTTCACCGCCGCCGAGGTGTCCTACAAGGCTGTCGAGGAGTCGGAGACGC
TCCAACTGGCGGTCAGCTCTGAGCCCGGTGAGGGTGGAATTGTCAACCTG
AACGAGTACAACAAGCGCTTCTCCTCCCATTTCTTCGACTGGGTGGCCTT
CGCCGTGATGACTCTGCCTTCCCTGGCCATTCCTCTGGCTCTGTGGCACC
AGTCCAAGAGCAAATATGAGCGCTCTGGAAAGAACAAGAAGCACTAAGCT
GCAGGACGGACGGTTTCCTCGCCACCACCAAGAGATTTCTTTGCAAAGAC
CCATTACAAATTCCGTATATTTTGTTGCTTTAGTTTCAAATTGATTCCAT
GCGTTGTTCATCTATTCAACCCACACATCTAATTTACTCCAGTCTGGGAC
TGTCGTCTGGAGACGGGCGTTAAATCGTTTTAGATTTGATTCGAGGGCGC
ATTGAGTAAAAAGTGAATAAAACAAGTCCATCAATGTTAAGCCTAGGCTG
CTTTTCTAAATAAATTAAATAAAATATAAAAAAAAAAAAAAAAAAAAAA

LD10457.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
SsRbeta-RA 1076 SsRbeta-RA 147..1076 1..930 4650 100 Plus
CG5161.a 433 CG5161.a 365..433 905..837 345 100 Minus
CG5161-RA 723 CG5161-RA 683..723 930..890 205 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16120270..16120748 449..927 2395 100 Plus
chr3L 24539361 chr3L 16119673..16120048 74..449 1880 100 Plus
chr3L 24539361 chr3L 16119405..16119477 1..73 365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:57:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16130505..16130986 449..930 2410 100 Plus
3L 28110227 3L 16129908..16130283 74..449 1880 100 Plus
3L 28110227 3L 16129640..16129712 1..73 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16123605..16124086 449..930 2410 100 Plus
3L 28103327 3L 16123008..16123383 74..449 1880 100 Plus
3L 28103327 3L 16122740..16122812 1..73 365 100 Plus
Blast to na_te.dros performed 2019-03-16 04:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
G7 1192 G7 G7 1192bp 1060..1168 831..927 121 64.5 Plus

LD10457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:04:40 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16119673..16120048 74..449 100 -> Plus
chr3L 16119405..16119477 1..73 100 -> Plus
chr3L 16120271..16120748 450..927 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:55 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..573 75..647 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:26 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..573 75..647 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:19 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..573 75..647 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:29 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..573 75..647 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:34 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..573 75..647 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:53 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:26 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:19 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 24..950 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:30 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:34 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
SsRbeta-RA 24..950 1..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:04:40 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16129640..16129712 1..73 100 -> Plus
3L 16129908..16130283 74..449 100 -> Plus
3L 16130506..16130983 450..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:04:40 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16129640..16129712 1..73 100 -> Plus
3L 16129908..16130283 74..449 100 -> Plus
3L 16130506..16130983 450..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:04:40 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16129640..16129712 1..73 100 -> Plus
3L 16129908..16130283 74..449 100 -> Plus
3L 16130506..16130983 450..927 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:19 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16122740..16122812 1..73 100 -> Plus
arm_3L 16123008..16123383 74..449 100 -> Plus
arm_3L 16123606..16124083 450..927 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:51 Download gff for LD10457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16123008..16123383 74..449 100 -> Plus
3L 16123606..16124083 450..927 100   Plus
3L 16122740..16122812 1..73 100 -> Plus

LD10457.hyp Sequence

Translation from 2 to 646

> LD10457.hyp
KAAACYDCCLVVLKYSIRKYPNYKMFKHLLTLFALCAVFSTCLSEDETRA
RLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVDSGFHPEAFDV
VGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETL
QLAVSSEPGEGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQ
SKSKYERSGKNKKH*

LD10457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
SsRbeta-PA 190 CG5474-PA 1..190 25..214 974 100 Plus

LD10457.pep Sequence

Translation from 74 to 646

> LD10457.pep
MFKHLLTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYT
IFNVGSGAATKVRLVDSGFHPEAFDVVGGQPTAVVDRIAPQTNFTHVLVV
RPKAFGYFNFTAAEVSYKAVEESETLQLAVSSEPGEGGIVNLNEYNKRFS
SHFFDWVAFAVMTLPSLAIPLALWHQSKSKYERSGKNKKH*

LD10457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24158-PA 190 GF24158-PA 1..190 1..190 956 93.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15954-PA 190 GG15954-PA 1..190 1..190 998 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16443-PA 190 GH16443-PA 1..190 1..190 875 85.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
SsRbeta-PA 190 CG5474-PA 1..190 1..190 974 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16699-PA 190 GI16699-PA 1..190 1..190 880 85.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17832-PA 190 GL17832-PA 1..190 1..190 910 88.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18908-PA 190 GA18908-PA 1..190 1..190 912 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25590-PA 190 GM25590-PA 1..190 1..190 1005 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14599-PA 190 GD14599-PA 1..190 1..190 1005 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12435-PA 190 GJ12435-PA 1..190 1..190 883 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16852-PA 190 GK16852-PA 1..190 1..190 906 87.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19524-PA 190 GE19524-PA 1..190 1..190 992 97.9 Plus
Dyak\SsRbeta-PA 190 GE23173-PA 1..190 1..190 992 97.9 Plus