BDGP Sequence Production Resources |
Search the DGRC for LD10457
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 104 |
Well: | 57 |
Vector: | pBS SK- |
Associated Gene/Transcript | SsRbeta-RA |
Protein status: | LD10457.pep: gold |
Preliminary Size: | 1139 |
Sequenced Size: | 949 |
Gene | Date | Evidence |
---|---|---|
CG5474 | 2001-01-01 | Release 2 assignment |
CG5474 | 2002-11-12 | Blastp of sequenced clone |
CG5474 | 2003-01-01 | Sim4 clustering to Release 3 |
SsRbeta | 2008-04-29 | Release 5.5 accounting |
SsRbeta | 2008-08-15 | Release 5.9 accounting |
SsRbeta | 2008-12-18 | 5.12 accounting |
949 bp (949 high quality bases) assembled on 2002-11-12
GenBank Submission: AF160923
> LD10457.complete AGAAAGCGGCTGCCTGCTACGACTGCTGCTTAGTTGTACTGAAATACTCG ATAAGGAAATACCCAAATTACAAAATGTTCAAGCACCTGCTGACTTTGTT CGCCCTGTGCGCGGTGTTTAGCACCTGCCTGTCGGAAGACGAGACCCGTG CCCGTCTCCTGGTCTCTAAGCAGATCCTGAACAAGTACCTGGTGGAGAAG AGCGACCTGTTGGTACGCTACACCATCTTCAACGTGGGCAGCGGTGCCGC CACCAAGGTGCGATTGGTAGACTCCGGCTTCCACCCGGAGGCCTTCGACG TTGTCGGAGGACAGCCCACCGCCGTGGTCGATAGGATCGCTCCCCAGACC AACTTCACCCATGTCCTGGTGGTGAGGCCCAAGGCCTTCGGCTACTTCAA CTTCACCGCCGCCGAGGTGTCCTACAAGGCTGTCGAGGAGTCGGAGACGC TCCAACTGGCGGTCAGCTCTGAGCCCGGTGAGGGTGGAATTGTCAACCTG AACGAGTACAACAAGCGCTTCTCCTCCCATTTCTTCGACTGGGTGGCCTT CGCCGTGATGACTCTGCCTTCCCTGGCCATTCCTCTGGCTCTGTGGCACC AGTCCAAGAGCAAATATGAGCGCTCTGGAAAGAACAAGAAGCACTAAGCT GCAGGACGGACGGTTTCCTCGCCACCACCAAGAGATTTCTTTGCAAAGAC CCATTACAAATTCCGTATATTTTGTTGCTTTAGTTTCAAATTGATTCCAT GCGTTGTTCATCTATTCAACCCACACATCTAATTTACTCCAGTCTGGGAC TGTCGTCTGGAGACGGGCGTTAAATCGTTTTAGATTTGATTCGAGGGCGC ATTGAGTAAAAAGTGAATAAAACAAGTCCATCAATGTTAAGCCTAGGCTG CTTTTCTAAATAAATTAAATAAAATATAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16120270..16120748 | 449..927 | 2395 | 100 | Plus |
chr3L | 24539361 | chr3L | 16119673..16120048 | 74..449 | 1880 | 100 | Plus |
chr3L | 24539361 | chr3L | 16119405..16119477 | 1..73 | 365 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 16123605..16124086 | 449..930 | 2410 | 100 | Plus |
3L | 28103327 | 3L | 16123008..16123383 | 74..449 | 1880 | 100 | Plus |
3L | 28103327 | 3L | 16122740..16122812 | 1..73 | 365 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
G7 | 1192 | G7 G7 1192bp | 1060..1168 | 831..927 | 121 | 64.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16119673..16120048 | 74..449 | 100 | -> | Plus |
chr3L | 16119405..16119477 | 1..73 | 100 | -> | Plus |
chr3L | 16120271..16120748 | 450..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..573 | 75..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..573 | 75..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..573 | 75..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..573 | 75..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..573 | 75..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..927 | 1..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..927 | 1..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 24..950 | 1..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 1..927 | 1..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SsRbeta-RA | 24..950 | 1..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16129640..16129712 | 1..73 | 100 | -> | Plus |
3L | 16129908..16130283 | 74..449 | 100 | -> | Plus |
3L | 16130506..16130983 | 450..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16129640..16129712 | 1..73 | 100 | -> | Plus |
3L | 16129908..16130283 | 74..449 | 100 | -> | Plus |
3L | 16130506..16130983 | 450..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16129640..16129712 | 1..73 | 100 | -> | Plus |
3L | 16129908..16130283 | 74..449 | 100 | -> | Plus |
3L | 16130506..16130983 | 450..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16122740..16122812 | 1..73 | 100 | -> | Plus |
arm_3L | 16123008..16123383 | 74..449 | 100 | -> | Plus |
arm_3L | 16123606..16124083 | 450..927 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16123008..16123383 | 74..449 | 100 | -> | Plus |
3L | 16123606..16124083 | 450..927 | 100 | Plus | |
3L | 16122740..16122812 | 1..73 | 100 | -> | Plus |
Translation from 2 to 646
> LD10457.hyp KAAACYDCCLVVLKYSIRKYPNYKMFKHLLTLFALCAVFSTCLSEDETRA RLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVDSGFHPEAFDV VGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETL QLAVSSEPGEGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQ SKSKYERSGKNKKH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SsRbeta-PA | 190 | CG5474-PA | 1..190 | 25..214 | 974 | 100 | Plus |
Translation from 74 to 646
> LD10457.pep MFKHLLTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYT IFNVGSGAATKVRLVDSGFHPEAFDVVGGQPTAVVDRIAPQTNFTHVLVV RPKAFGYFNFTAAEVSYKAVEESETLQLAVSSEPGEGGIVNLNEYNKRFS SHFFDWVAFAVMTLPSLAIPLALWHQSKSKYERSGKNKKH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24158-PA | 190 | GF24158-PA | 1..190 | 1..190 | 956 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15954-PA | 190 | GG15954-PA | 1..190 | 1..190 | 998 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16443-PA | 190 | GH16443-PA | 1..190 | 1..190 | 875 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SsRbeta-PA | 190 | CG5474-PA | 1..190 | 1..190 | 974 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16699-PA | 190 | GI16699-PA | 1..190 | 1..190 | 880 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17832-PA | 190 | GL17832-PA | 1..190 | 1..190 | 910 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18908-PA | 190 | GA18908-PA | 1..190 | 1..190 | 912 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25590-PA | 190 | GM25590-PA | 1..190 | 1..190 | 1005 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14599-PA | 190 | GD14599-PA | 1..190 | 1..190 | 1005 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12435-PA | 190 | GJ12435-PA | 1..190 | 1..190 | 883 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16852-PA | 190 | GK16852-PA | 1..190 | 1..190 | 906 | 87.9 | Plus |