Clone LD10749 Report

Search the DGRC for LD10749

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:107
Well:49
Vector:pBS SK-
Associated Gene/TranscriptCG12659-RC
Protein status:LD10749.pep: gold
Preliminary Size:2202
Sequenced Size:886

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12659 2001-11-09 Blastp of sequenced clone
CG12659 2003-01-01 Sim4 clustering to Release 3
CG12659 2008-04-29 Release 5.5 accounting
CG12659 2008-08-15 Release 5.9 accounting
CG12659 2008-12-18 5.12 accounting

Clone Sequence Records

LD10749.complete Sequence

886 bp (886 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069409

> LD10749.complete
GAAATATGGAACAAAATGCGAAGCCTAAACGCTCCTTTAAGCGTCCGTTT
ACCTTTCCAAAGAACTGTGTTTACCGCCCTCTACGTCAGATAAGCAACAT
GGAGCGTAGCCAGAAGCTGTCCGCCGAACAACCCACCTACTTCACGCTCA
ATGCACCGCCCTCGTTGGTTCCGGCCAAGAAGTACTCGGATATCAGCGGT
CTGCCCGCTCCTTATGCCGATCCGCACACGAAACTAAGGTTCGCCAGCGC
CGACGAGTACGCGTCCATGCAGCACATGCCCTCGGACATCGTCAATGGCT
ACCTCATGGTGCGCGGCTATACCAGCGCCGTGGGATAGTTTGTTCGATCC
ATATACTGCATACATCCCAAGTACTCGCTGTGTTCCGCACCTGGAGGCCT
TGCGTTGCAACTACCACTCATAATAGGCAATTAGAGCGCTGCTGACCTTA
CTCTTACTGGCATTGCGTGCGAGGCTGTTGCTTTCAAGTGATTCGATGAC
TGTTTCCTGCCTGGAACACCGCGTTCAAGGGGAGTTACATCCACAATTAC
CATATATATATATATATGCATACACTGCCTAAAAGGAGATGATCTCTGTA
AATTAGTTATAGAGATTTGTCACTAGTTTGACCGCAAAAATAGATTAGGT
AATTCCAAGGTGAGATGAATACCTTGGCGGTTTGAAAGTGTCTAAATTAA
CGAAACGGCTGCCACATAGATCCTAATGCGAAAAGCAAATATTTAAACAG
CCGACTCGTGCAAGTTTGGAGTTCGCAATGAACGGCCCACAGATTAATAT
AGTGTTAAGTTAACCAGCTATACAAAATTCAGCAAGAAGGCAAAGTAAAC
AAAACTGAATAATATGAAAAAAAAAAAAAAAAAAAA

LD10749.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-RB 1317 CG12659-RB 293..1159 1..867 4335 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8482532..8483259 866..139 3625 99.9 Minus
chrX 22417052 chrX 8483319..8483456 138..1 690 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:57:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8590774..8591502 867..139 3645 100 Minus
X 23542271 X 8591562..8591699 138..1 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8598872..8599600 867..139 3645 100 Minus
X 23527363 X 8599660..8599797 138..1 690 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:24:50 has no hits.

LD10749.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:34 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8482532..8483259 139..866 99 <- Minus
chrX 8483319..8483456 1..138 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:44:20 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 1..333 6..338 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:10 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 1..333 6..338 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:52:35 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 1..333 6..338 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:34 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 1..333 6..338 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:31 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 1..333 6..338 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:32 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 293..1158 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:10 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 293..1158 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:35 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 31..896 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:34 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 293..1158 1..866 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:31 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 31..896 1..866 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:34 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
X 8590775..8591502 139..866 100 <- Minus
X 8591562..8591699 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:34 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
X 8590775..8591502 139..866 100 <- Minus
X 8591562..8591699 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:34 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
X 8590775..8591502 139..866 100 <- Minus
X 8591562..8591699 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:35 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8484808..8485535 139..866 100 <- Minus
arm_X 8485595..8485732 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:10 Download gff for LD10749.complete
Subject Subject Range Query Range Percent Splice Strand
X 8598873..8599600 139..866 100 <- Minus
X 8599660..8599797 1..138 100   Minus

LD10749.hyp Sequence

Translation from 2 to 337

> LD10749.hyp
NMEQNAKPKRSFKRPFTFPKNCVYRPLRQISNMERSQKLSAEQPTYFTLN
APPSLVPAKKYSDISGLPAPYADPHTKLRFASADEYASMQHMPSDIVNGY
LMVRGYTSAVG*

LD10749.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-PC 110 CG12659-PC 1..110 2..111 580 100 Plus

LD10749.pep Sequence

Translation from 5 to 337

> LD10749.pep
MEQNAKPKRSFKRPFTFPKNCVYRPLRQISNMERSQKLSAEQPTYFTLNA
PPSLVPAKKYSDISGLPAPYADPHTKLRFASADEYASMQHMPSDIVNGYL
MVRGYTSAVG*

LD10749.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22651-PA 110 GF22651-PA 1..110 1..110 507 85.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19034-PA 110 GG19034-PA 1..110 1..110 549 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24073-PA 114 GH24073-PA 10..114 6..110 478 81.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-PC 110 CG12659-PC 1..110 1..110 580 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15522-PA 112 GI15522-PA 8..112 6..110 459 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22444-PA 78 GL22444-PA 1..78 32..109 355 85.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11742-PA 78 GA11742-PA 1..78 32..109 355 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21203-PA 79 GM21203-PA 1..79 32..110 415 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24565-PA 79 GD24565-PA 1..79 32..110 415 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19279-PA 113 GJ19279-PA 2..113 1..110 491 81.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19831-PA 110 GK19831-PA 1..110 1..110 527 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17441-PA 79 GE17441-PA 1..79 32..110 392 93.7 Plus