BDGP Sequence Production Resources |
Search the DGRC for LD11057
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 110 |
Well: | 57 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG1943-RA |
Protein status: | LD11057.pep: gold |
Sequenced Size: | 1021 |
Gene | Date | Evidence |
---|---|---|
CG1943 | 2004-03-31 | Blastp of sequenced clone |
CG1943 | 2008-04-29 | Release 5.5 accounting |
CG1943 | 2008-08-15 | Release 5.9 accounting |
CG1943 | 2008-12-18 | 5.12 accounting |
1021 bp (1021 high quality bases) assembled on 2004-03-31
GenBank Submission: BT012490
> LD11057.complete ATTTGCCAGTGGTGGGGTGATGTCGGATGACGGGCGTCATTGTGCCGGGC GTCACATCCGCAAGTGGCGTGACTGAATTTGTAGTCTAGGTCACTGAAAC CACAACCAGCAGCGACAAAATGACATCCACCGAGCTGAAAATCGGCCTGA CCACCAGTGCCCGTCCCTCCAGCCGAGTGCTGAAGCCCCCAGGCGGCGGA CACACCAATATCTTCTCGGAGCCCGACGTGGCCGTTCCCGCCCCGCGTGC CAAGTACAACCAACAGAACTCCTCAAACCTCAATGCCTGCATGGGCTCCA CGGATCCCAACAAGGTGGTGGAGAAAATTCGCGAAGAGGTCTCCATCCAG AAGGAGGAGGCCAAGTCCGCCCCACCCAGCCAGCCCAAGGAGCCGGCGAA CAAACCAGCGGCCACAAATGGAGAGGCACGCGGCCGAGTTCCACCCGGCG GATTCTCGTCGGGCGGATTCTGGTAGAGGGAGGAAGGAGGGAAGGAAGTG TGCCCGGGAGCAGAAGCAGCTGCCAAGCATTTAATGACTCACCATCACAT CCTCAGACCGACATAAGAATCATAAAACTATAAATATACATAACTCGCTT ATAACATACGTATACACCTATATTTAGAGGCGCATTACCTATATTAACCT GCTGATCAGCCGAAGAAGAAGGGAAACTGATTATATTTTGCCAAGCAGCA CTCCAAGTCGTTCTTCCTTTCGCCCTTTCATTTTCATGTCCCACATTTGT TCTATTGTCTAAGTAACAGGTTTAAAATGTCTAACGAAATTGTTGAAATT AAGTAACTCGTGATTCCGCCCCACAAATACGGATGATATGGATTGACTTT GCTAAAATCTACCACCTACTAAGCCTAATTTAGCATTTGTACTTAAAGTG TCCAATCGAATCTTCTTATAGTCTGTAAAATTCGTCCAAACGAATACCAA TATAACCATCGATGTATTACTCCAAATAAAACATTTAATTGTAAAAAAAA AAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1943-RB | 987 | CG1943-RB | 1..987 | 2..988 | 4935 | 100 | Plus |
CG1943-RA | 1280 | CG1943-RA | 253..1157 | 90..994 | 4525 | 100 | Plus |
CG1943-RC | 981 | CG1943-RC | 83..981 | 90..988 | 4495 | 100 | Plus |
CG1943-RC | 981 | CG1943-RC | 1..30 | 61..90 | 150 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 2902776..2902865 | 1..90 | 100 | -> | Plus |
chr3R | 2902919..2903820 | 91..992 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RC | 1..357 | 120..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RC | 1..357 | 120..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..357 | 120..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RC | 1..357 | 120..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..357 | 120..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..987 | 2..988 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..987 | 2..988 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..991 | 2..992 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..987 | 2..988 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1943-RB | 1..991 | 2..992 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7076747..7076836 | 1..90 | 100 | -> | Plus |
3R | 7076890..7077791 | 91..992 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7076747..7076836 | 1..90 | 100 | -> | Plus |
3R | 7076890..7077791 | 91..992 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7076747..7076836 | 1..90 | 100 | -> | Plus |
3R | 7076890..7077791 | 91..992 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 2902469..2902558 | 1..90 | 100 | -> | Plus |
arm_3R | 2902612..2903513 | 91..992 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6817721..6818622 | 91..992 | 100 | Plus | |
3R | 6817578..6817667 | 1..90 | 100 | -> | Plus |
Translation from 119 to 475
> LD11057.hyp MTSTELKIGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQN SSNLNACMGSTDPNKVVEKIREEVSIQKEEAKSAPPSQPKEPANKPAATN GEARGRVPPGGFSSGGFW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1943-PD | 118 | CG1943-PD | 1..118 | 1..118 | 618 | 100 | Plus |
CG1943-PC | 118 | CG1943-PC | 1..118 | 1..118 | 618 | 100 | Plus |
CG1943-PB | 118 | CG1943-PB | 1..118 | 1..118 | 618 | 100 | Plus |
CG1943-PA | 118 | CG1943-PA | 1..118 | 1..118 | 618 | 100 | Plus |
Translation from 119 to 475
> LD11057.pep MTSTELKIGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQN SSNLNACMGSTDPNKVVEKIREEVSIQKEEAKSAPPSQPKEPANKPAATN GEARGRVPPGGFSSGGFW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13598-PA | 118 | GF13598-PA | 1..118 | 1..118 | 518 | 84.7 | Plus |
Dana\GF13609-PA | 118 | GF13609-PA | 1..118 | 1..118 | 518 | 84.7 | Plus |
Dana\GF13989-PA | 118 | GF13989-PA | 1..118 | 1..118 | 518 | 84.7 | Plus |
Dana\GF21615-PA | 118 | GF21615-PA | 1..118 | 1..118 | 518 | 84.7 | Plus |
Dana\GF25111-PA | 118 | GF25111-PA | 1..118 | 1..118 | 518 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13786-PA | 118 | GG13786-PA | 1..118 | 1..118 | 604 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18999-PA | 123 | GH18999-PA | 1..123 | 1..118 | 450 | 71.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1943-PD | 118 | CG1943-PD | 1..118 | 1..118 | 618 | 100 | Plus |
CG1943-PC | 118 | CG1943-PC | 1..118 | 1..118 | 618 | 100 | Plus |
CG1943-PB | 118 | CG1943-PB | 1..118 | 1..118 | 618 | 100 | Plus |
CG1943-PA | 118 | CG1943-PA | 1..118 | 1..118 | 618 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24501-PA | 120 | GI24501-PA | 1..120 | 1..118 | 427 | 75.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11943-PA | 118 | GL11943-PA | 1..118 | 1..118 | 525 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15144-PA | 118 | GA15144-PA | 1..118 | 1..118 | 525 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18778-PA | 118 | GM18778-PA | 1..118 | 1..118 | 604 | 99.2 | Plus |
Dsec\GM10928-PA | 159 | GM10928-PA | 1..103 | 1..102 | 349 | 70.2 | Plus |
Dsec\GM10405-PA | 65 | GM10405-PA | 18..64 | 48..112 | 201 | 66.2 | Plus |
Dsec\GM10929-PA | 65 | GM10929-PA | 18..64 | 48..112 | 201 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19907-PA | 118 | GD19907-PA | 1..118 | 1..118 | 604 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24566-PA | 119 | GJ24566-PA | 1..119 | 1..118 | 481 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12740-PA | 118 | GK12740-PA | 1..118 | 1..118 | 466 | 73.7 | Plus |