Clone LD11057 Report

Search the DGRC for LD11057

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:110
Well:57
Vector:pBS SK-
Associated Gene/TranscriptCG1943-RA
Protein status:LD11057.pep: gold
Sequenced Size:1021

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1943 2004-03-31 Blastp of sequenced clone
CG1943 2008-04-29 Release 5.5 accounting
CG1943 2008-08-15 Release 5.9 accounting
CG1943 2008-12-18 5.12 accounting

Clone Sequence Records

LD11057.complete Sequence

1021 bp (1021 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012490

> LD11057.complete
ATTTGCCAGTGGTGGGGTGATGTCGGATGACGGGCGTCATTGTGCCGGGC
GTCACATCCGCAAGTGGCGTGACTGAATTTGTAGTCTAGGTCACTGAAAC
CACAACCAGCAGCGACAAAATGACATCCACCGAGCTGAAAATCGGCCTGA
CCACCAGTGCCCGTCCCTCCAGCCGAGTGCTGAAGCCCCCAGGCGGCGGA
CACACCAATATCTTCTCGGAGCCCGACGTGGCCGTTCCCGCCCCGCGTGC
CAAGTACAACCAACAGAACTCCTCAAACCTCAATGCCTGCATGGGCTCCA
CGGATCCCAACAAGGTGGTGGAGAAAATTCGCGAAGAGGTCTCCATCCAG
AAGGAGGAGGCCAAGTCCGCCCCACCCAGCCAGCCCAAGGAGCCGGCGAA
CAAACCAGCGGCCACAAATGGAGAGGCACGCGGCCGAGTTCCACCCGGCG
GATTCTCGTCGGGCGGATTCTGGTAGAGGGAGGAAGGAGGGAAGGAAGTG
TGCCCGGGAGCAGAAGCAGCTGCCAAGCATTTAATGACTCACCATCACAT
CCTCAGACCGACATAAGAATCATAAAACTATAAATATACATAACTCGCTT
ATAACATACGTATACACCTATATTTAGAGGCGCATTACCTATATTAACCT
GCTGATCAGCCGAAGAAGAAGGGAAACTGATTATATTTTGCCAAGCAGCA
CTCCAAGTCGTTCTTCCTTTCGCCCTTTCATTTTCATGTCCCACATTTGT
TCTATTGTCTAAGTAACAGGTTTAAAATGTCTAACGAAATTGTTGAAATT
AAGTAACTCGTGATTCCGCCCCACAAATACGGATGATATGGATTGACTTT
GCTAAAATCTACCACCTACTAAGCCTAATTTAGCATTTGTACTTAAAGTG
TCCAATCGAATCTTCTTATAGTCTGTAAAATTCGTCCAAACGAATACCAA
TATAACCATCGATGTATTACTCCAAATAAAACATTTAATTGTAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

LD11057.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG1943-RB 987 CG1943-RB 1..987 2..988 4935 100 Plus
CG1943-RA 1280 CG1943-RA 253..1157 90..994 4525 100 Plus
CG1943-RC 981 CG1943-RC 83..981 90..988 4495 100 Plus
CG1943-RC 981 CG1943-RC 1..30 61..90 150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2902920..2903820 92..992 4505 100 Plus
chr3R 27901430 chr3R 2902776..2902865 1..90 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:57:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7076889..7077793 90..994 4525 100 Plus
3R 32079331 3R 7076747..7076836 1..90 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6817720..6818624 90..994 4525 100 Plus
3R 31820162 3R 6817578..6817667 1..90 450 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:12:00 has no hits.

LD11057.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:07 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2902776..2902865 1..90 100 -> Plus
chr3R 2902919..2903820 91..992 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:44:47 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RC 1..357 120..476 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:38:38 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RC 1..357 120..476 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:18 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..357 120..476 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:22 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RC 1..357 120..476 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:02:19 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..357 120..476 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:46:39 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..987 2..988 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:38:38 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..987 2..988 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:18 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..991 2..992 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:23 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..987 2..988 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:02:19 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 1..991 2..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:07 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7076747..7076836 1..90 100 -> Plus
3R 7076890..7077791 91..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:07 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7076747..7076836 1..90 100 -> Plus
3R 7076890..7077791 91..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:07 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7076747..7076836 1..90 100 -> Plus
3R 7076890..7077791 91..992 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:18 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2902469..2902558 1..90 100 -> Plus
arm_3R 2902612..2903513 91..992 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:48 Download gff for LD11057.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6817721..6818622 91..992 100   Plus
3R 6817578..6817667 1..90 100 -> Plus

LD11057.hyp Sequence

Translation from 119 to 475

> LD11057.hyp
MTSTELKIGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQN
SSNLNACMGSTDPNKVVEKIREEVSIQKEEAKSAPPSQPKEPANKPAATN
GEARGRVPPGGFSSGGFW*

LD11057.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1943-PD 118 CG1943-PD 1..118 1..118 618 100 Plus
CG1943-PC 118 CG1943-PC 1..118 1..118 618 100 Plus
CG1943-PB 118 CG1943-PB 1..118 1..118 618 100 Plus
CG1943-PA 118 CG1943-PA 1..118 1..118 618 100 Plus

LD11057.pep Sequence

Translation from 119 to 475

> LD11057.pep
MTSTELKIGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQN
SSNLNACMGSTDPNKVVEKIREEVSIQKEEAKSAPPSQPKEPANKPAATN
GEARGRVPPGGFSSGGFW*

LD11057.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13598-PA 118 GF13598-PA 1..118 1..118 518 84.7 Plus
Dana\GF13609-PA 118 GF13609-PA 1..118 1..118 518 84.7 Plus
Dana\GF13989-PA 118 GF13989-PA 1..118 1..118 518 84.7 Plus
Dana\GF21615-PA 118 GF21615-PA 1..118 1..118 518 84.7 Plus
Dana\GF25111-PA 118 GF25111-PA 1..118 1..118 518 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13786-PA 118 GG13786-PA 1..118 1..118 604 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18999-PA 123 GH18999-PA 1..123 1..118 450 71.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG1943-PD 118 CG1943-PD 1..118 1..118 618 100 Plus
CG1943-PC 118 CG1943-PC 1..118 1..118 618 100 Plus
CG1943-PB 118 CG1943-PB 1..118 1..118 618 100 Plus
CG1943-PA 118 CG1943-PA 1..118 1..118 618 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24501-PA 120 GI24501-PA 1..120 1..118 427 75.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11943-PA 118 GL11943-PA 1..118 1..118 525 84.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15144-PA 118 GA15144-PA 1..118 1..118 525 84.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18778-PA 118 GM18778-PA 1..118 1..118 604 99.2 Plus
Dsec\GM10928-PA 159 GM10928-PA 1..103 1..102 349 70.2 Plus
Dsec\GM10405-PA 65 GM10405-PA 18..64 48..112 201 66.2 Plus
Dsec\GM10929-PA 65 GM10929-PA 18..64 48..112 201 66.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19907-PA 118 GD19907-PA 1..118 1..118 604 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24566-PA 119 GJ24566-PA 1..119 1..118 481 81.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12740-PA 118 GK12740-PA 1..118 1..118 466 73.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11174-PA 118 GE11174-PA 1..118 1..118 598 98.3 Plus
Dyak\GE24898-PA 118 GE24898-PA 1..118 1..118 598 98.3 Plus