Clone LD11379 Report

Search the DGRC for LD11379

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:113
Well:79
Vector:pBS SK-
Associated Gene/TranscriptHsp26-RA
Protein status:LD11379.pep: gold
Preliminary Size:1106
Sequenced Size:961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4183 2001-01-01 Release 2 assignment
CG4183 2003-01-01 Sim4 clustering to Release 3
CG4183 2003-04-23 Blastp of sequenced clone
Hsp26 2008-04-29 Release 5.5 accounting
Hsp26 2008-08-15 Release 5.9 accounting
Hsp26 2008-12-18 5.12 accounting

Clone Sequence Records

LD11379.complete Sequence

961 bp (961 high quality bases) assembled on 2003-04-23

GenBank Submission: AY069419

> LD11379.complete
CAAAAATCGAGCAGTGAACAACTCAAAGCAACTTTGCGCAAAAGCAAAAC
TTCAAACGAGAAAAAAAAGGATTAAAAACCTTTGCTTACAAGTCAAACAA
GTTCATTCAACTTAACCAAAGAAAAAATATTTCAATCTCGCAAAAGGAAC
ATAACCTAAAGGAAACGTAAAAATGTCGCTATCTACTCTGCTTTCGCTTG
TGGATGAACTCCAGGAGCCCCGCAGCCCCATCTACGAGCTTGGACTGGGA
TTGCATCCGCATTCCCGCTACGTGCTGCCCCTTGGCACTCAGCAGCGCCG
TTCCATCAACGGATGCCCTTGCGCATCGCCGATATGCCCATCGTCGCCCG
CCGGCCAGGTTTTGGCTTTGCGGCGCGAGATGGCCAACCGCAACGACATT
CACTGGCCGGCAACCGCCCATGTGGGCAAGGATGGATTCCAGGTGTGCAT
GGACGTCGCCCAGTTCAAGCCCAGTGAGCTCAACGTGAAGGTGGTGGACG
ACTCCATCTTGGTCGAGGGCAAGCATGAGGAACGCCAGGACGACCATGGT
CACATCATGCGCCACTTTGTGCGCCGCTACAAGGTTCCCGATGGCTACAA
GGCGGAGCAAGTGGTCTCGCAGCTGTCGTCGGATGGCGTGCTCACCGTCA
GTATTCCCAAGCCGCAGGCCGTCGAGGACAAGTCCAAGGAGCGCATCATT
CAAATTCAGCAAGTGGGACCCGCTCACCTCAACGTTAAGGCAAATGAAAG
CGAGGTGAAGGGCAAGGAGAACGGAGCACCCAACGGCAAGGACAAGTAAA
GGAGCCATCATCATCCAACATCATCCATCATCATTCCCCTACTTAATTGT
TCCTAATTTATTGCATTGTATTTGTAATGAGCTAAAGACTAGAATACTCA
TATTAATTTAATAAATCCTTTTGTTCACCTGGTGTGGAAAATTAAAAAAA
AAAAAAAAAAA

LD11379.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp26-RA 1010 Hsp26-RA 68..1010 1..943 4715 100 Plus
Hsp27-RA 1220 Hsp27-RA 374..526 422..574 330 81 Plus
Hsp23-RA 884 Hsp23-RA 316..467 428..579 265 78.2 Plus
Hsp23-RA 884 Hsp23-RA 512..628 624..740 195 77.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9368306..9369248 943..1 4715 100 Minus
chr3L 24539361 chr3L 9374099..9374411 428..740 335 73.8 Plus
chr3L 24539361 chr3L 9376343..9376495 422..574 330 81 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:58:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9376414..9377360 947..1 4735 100 Minus
3L 28110227 3L 9382199..9382511 428..740 335 73.8 Plus
3L 28110227 3L 9384438..9384590 422..574 330 81 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9369514..9370460 947..1 4735 100 Minus
3L 28103327 3L 9377538..9377690 422..574 330 81 Plus
3L 28103327 3L 9375299..9375450 428..579 265 78.2 Plus
3L 28103327 3L 9375495..9375611 624..740 195 77.7 Plus
Blast to na_te.dros performed 2019-03-15 22:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dm88 4558 Dm88 DM88 4558bp 1614..1670 93..149 131 74.1 Plus

LD11379.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:17:38 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9368306..9369248 1..943 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:45:08 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 1..627 173..799 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:13 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 1..627 173..799 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:14:02 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 1..627 173..799 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:39 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 1..627 173..799 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:17:01 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 1..627 173..799 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:56:10 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 68..1010 1..943 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:13 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 68..1010 1..943 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:14:02 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 16..958 1..943 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:40 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 68..1010 1..943 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:17:01 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp26-RA 16..958 1..943 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:38 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9376418..9377360 1..943 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:38 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9376418..9377360 1..943 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:38 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9376418..9377360 1..943 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:14:02 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9369518..9370460 1..943 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:42 Download gff for LD11379.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9369518..9370460 1..943 100   Minus

LD11379.pep Sequence

Translation from 172 to 798

> LD11379.pep
MSLSTLLSLVDELQEPRSPIYELGLGLHPHSRYVLPLGTQQRRSINGCPC
ASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKP
SELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ
LSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKEN
GAPNGKDK*

LD11379.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23739-PA 205 GF23739-PA 1..205 1..208 879 80.8 Plus
Dana\GF10691-PA 190 GF10691-PA 66..190 84..208 465 70.4 Plus
Dana\GF10692-PA 219 GF10692-PA 1..211 1..202 353 45.7 Plus
Dana\GF23740-PA 195 GF23740-PA 81..190 89..203 287 47.8 Plus
Dana\GF10689-PA 174 GF10689-PA 56..157 79..182 268 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14047-PA 208 GG14047-PA 1..208 1..208 1058 94.7 Plus
Dere\GG15370-PA 187 GG15370-PA 67..184 84..201 458 71.2 Plus
Dere\GG15371-PA 212 GG15371-PA 1..204 1..202 377 47.9 Plus
Dere\GG14048-PA 199 GG14048-PA 81..182 89..191 289 52.4 Plus
Dere\GG20009-PA 187 GG20009-PA 70..184 80..195 268 44 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14700-PA 204 GH14700-PA 1..197 1..206 523 53.8 Plus
Dgri\GH17008-PA 180 GH17008-PA 59..172 81..194 487 78.1 Plus
Dgri\GH23707-PA 185 GH23707-PA 64..177 81..194 484 78.9 Plus
Dgri\GH16863-PA 185 GH16863-PA 64..177 81..194 484 78.9 Plus
Dgri\GH17009-PA 218 GH17009-PA 89..213 84..208 408 62.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp26-PB 208 CG4183-PB 1..208 1..208 1089 100 Plus
Hsp26-PA 208 CG4183-PA 1..208 1..208 1089 100 Plus
Hsp23-PB 186 CG4463-PB 62..183 80..201 457 68.9 Plus
Hsp23-PA 186 CG4463-PA 62..183 80..201 457 68.9 Plus
Hsp27-PB 213 CG4466-PB 1..205 1..202 396 47 Plus
Hsp27-PA 213 CG4466-PA 1..205 1..202 396 47 Plus
Hsp67Bc-PA 199 CG4190-PA 81..199 89..208 288 47.5 Plus
l(2)efl-PC 187 CG4533-PC 70..183 80..194 268 44.3 Plus
l(2)efl-PA 187 CG4533-PA 70..183 80..194 268 44.3 Plus
Hsp67Ba-PA 445 CG4167-PA 122..222 84..181 262 51.5 Plus
Hsp22-PB 174 CG4460-PB 43..157 68..182 251 44.4 Plus
Hsp22-PA 174 CG4460-PA 43..157 68..182 251 44.4 Plus
CG7409-PA 154 CG7409-PA 53..153 84..189 240 45.3 Plus
CG4461-PA 200 CG4461-PA 92..193 83..182 221 40.2 Plus
CG13133-PA 217 CG13133-PA 82..181 84..182 164 38.2 Plus
CG14207-PC 154 CG14207-PC 71..140 94..164 156 45.1 Plus
CG14207-PD 183 CG14207-PD 100..169 94..164 156 45.1 Plus
CG14207-PA 183 CG14207-PA 100..169 94..164 156 45.1 Plus
CG14207-PB 192 CG14207-PB 109..178 94..164 156 45.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12247-PA 211 GI12247-PA 1..202 1..198 581 56 Plus
Dmoj\GI13088-PA 212 GI13088-PA 1..192 1..191 566 60.6 Plus
Dmoj\GI13085-PA 185 GI13085-PA 62..183 81..202 485 73 Plus
Dmoj\GI13087-PA 209 GI13087-PA 1..202 1..202 418 50 Plus
Dmoj\GI12244-PA 183 GI12244-PA 43..167 68..191 355 50.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22632-PA 204 GL22632-PA 1..204 1..208 854 77.4 Plus
Dper\GL22446-PA 184 GL22446-PA 3..174 2..192 469 55.2 Plus
Dper\GL22443-PA 184 GL22443-PA 3..174 2..192 469 55.2 Plus
Dper\GL22447-PA 225 GL22447-PA 1..201 1..192 357 47.1 Plus
Dper\GL22445-PA 225 GL22445-PA 1..201 1..192 357 47.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18011-PA 204 GA18011-PA 1..204 1..208 854 77.4 Plus
Dpse\GA18202-PA 184 GA18202-PA 3..174 2..192 474 55.7 Plus
Dpse\GA18205-PA 225 GA18205-PA 1..201 1..192 357 47.1 Plus
Dpse\GA28726-PA 144 GA28726-PA 12..118 84..190 333 64.5 Plus
Dpse\GA24923-PA 196 GA24923-PA 78..182 86..191 307 54.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24881-PA 211 GM24881-PA 1..211 1..208 1056 94.8 Plus
Dsec\GM25142-PA 183 GM25142-PA 59..180 80..201 456 68.9 Plus
Dsec\GM25143-PA 213 GM25143-PA 1..205 1..202 352 47.5 Plus
Dsec\GM24882-PA 199 GM24882-PA 81..182 89..191 288 52.4 Plus
Dsec\GM15521-PA 187 GM15521-PA 70..184 80..195 269 44 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12933-PA 211 GD12933-PA 1..211 1..208 1076 96.2 Plus
Dsim\GD14176-PA 177 GD14176-PA 66..174 84..201 405 65.3 Plus
Dsim\GD14177-PA 213 GD14177-PA 1..205 1..202 353 45.1 Plus
Dsim\GD12934-PA 199 GD12934-PA 81..182 89..191 287 52.4 Plus
Dsim\GD25025-PA 187 GD25025-PA 70..184 80..195 269 44 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11479-PA 216 GJ11479-PA 1..210 1..207 647 59.8 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 1..210 1..206 631 59.6 Plus
Dvir\GJ13834-PA 186 GJ13834-PA 63..176 81..194 481 77.2 Plus
Dvir\GJ13835-PA 211 GJ13835-PA 1..204 1..201 415 48.6 Plus
Dvir\GJ13837-PA 193 GJ13837-PA 77..181 86..191 294 50.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16566-PA 216 GK16566-PA 1..215 1..208 714 65.3 Plus
Dwil\GK17636-PA 186 GK17636-PA 62..186 81..208 471 69.5 Plus
Dwil\GK17637-PA 227 GK17637-PA 75..199 62..190 339 58.1 Plus
Dwil\GK19253-PA 192 GK19253-PA 76..188 85..196 283 48.2 Plus
Dwil\GK17635-PA 177 GK17635-PA 56..177 82..202 278 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21250-PA 208 GE21250-PA 1..208 1..208 1049 93.3 Plus
Dyak\GE20832-PA 186 GE20832-PA 62..183 80..201 455 68 Plus
Dyak\GE20833-PA 212 GE20833-PA 1..204 1..202 374 47.4 Plus
Dyak\Hsp67Bc-PA 199 GE21251-PA 81..182 89..191 288 52.4 Plus
Dyak\GE11545-PA 187 GE11545-PA 70..184 80..195 269 44 Plus

LD11379.hyp Sequence

Translation from 172 to 798

> LD11379.hyp
MSLSTLLSLVDELQEPRSPIYELGLGLHPHSRYVLPLGTQQRRSINGCPC
ASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKP
SELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ
LSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKEN
GAPNGKDK*

LD11379.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp26-PB 208 CG4183-PB 1..208 1..208 1089 100 Plus
Hsp26-PA 208 CG4183-PA 1..208 1..208 1089 100 Plus
Hsp23-PB 186 CG4463-PB 62..183 80..201 457 68.9 Plus
Hsp23-PA 186 CG4463-PA 62..183 80..201 457 68.9 Plus
Hsp27-PB 213 CG4466-PB 1..205 1..202 396 47 Plus