Clone LD11847 Report

Search the DGRC for LD11847

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:118
Well:47
Vector:pBS SK-
Associated Gene/TranscriptRpS15Ab-RA
Protein status:LD11847.pep: gold
Preliminary Size:889
Sequenced Size:700

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12324 2001-01-01 Release 2 assignment
CG12324 2001-10-10 Blastp of sequenced clone
CG12324 2003-01-01 Sim4 clustering to Release 3
RpS15Ab 2008-04-29 Release 5.5 accounting
RpS15Ab 2008-08-15 Release 5.9 accounting
RpS15Ab 2008-12-18 5.12 accounting

Clone Sequence Records

LD11847.complete Sequence

700 bp (700 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061830

> LD11847.complete
AGAAGTACTTACGGAAGTTTTCAAGTAAAGGTTTTTTCCCTTTTTCACGT
TTGCGTGACGGTCGTGTAAAACAGTTTTGGCAAACAAATCCAGCTATGGT
GCGTATGAACGTATTGGCCGATGCCCTGAAGTGCATAAACAACGCCGAGA
AGCGTGGCAAGCGGCAGGTGCTGCTGCGTCCCTGCTCCAAGGTGATCATC
AAGTTCCTGACCGTGATGATGAAGCATGGCTATATCGGCGAATTCGAGAT
CGTCGAGGATCACCGTGCCGGCAAGATCGTTGTCAACCTGACCGGTCGGC
TAAACAAGTGCGGCGTCATCTCGCCCCGCTTCGATGCGCCCATCAACGAC
ATCGAGAAGTGGACCAACAATCTGTTGCCCTCGCGTCAGTTTGGTTACGT
TGTGCTCACCACCTCTGGCGGCATCATGGACCACGAGGAGGCTAGGAGAA
AACATTTGGGAGGCAAAATTCTCGGCTTCTTCTTCTAGAGACACCAAGTT
CACATCGTAGAGGGATGGAGTTTGATATGTAGATTGACGTTTTATTTCAC
CGACCATGCATCCAACTATGTACTTTGTGCACAGGAAACAAAGGGCGAAA
ACGCTACTACGTTCATTCAGAAAACAAACGACGATGAATGTTCACAAAGT
TACGCGAAATAAAATGAAAAATTTGGACATCTAAAAAAAAAAAAAAAAAA

LD11847.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15Ab-RA 739 RpS15Ab-RA 48..731 1..684 3420 100 Plus
RpS15Aa-RF 881 RpS15Aa-RF 77..555 34..512 2230 97.7 Plus
RpS15Aa-RA 850 RpS15Aa-RA 43..525 34..512 2165 96.8 Plus
RpS15Aa-RF 881 RpS15Aa-RF 575..725 517..667 710 98 Plus
RpS15Aa-RA 850 RpS15Aa-RA 545..695 517..667 710 98 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6709255..6709936 1..682 3395 99.9 Plus
chrX 22417052 chrX 13226623..13227214 667..91 2475 94.9 Minus
chr2L 23010047 chr2L 14745517..14745767 667..431 725 87.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:58:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10821718..10822401 1..684 3420 100 Plus
X 23542271 X 13335791..13336382 667..91 2475 94.9 Minus
2L 23513712 2L 14746825..14747075 667..431 725 87.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10822917..10823600 1..684 3420 100 Plus
X 23527363 X 13344059..13344480 512..91 1960 97.6 Minus
X 23527363 X 13343889..13344039 667..517 710 98 Minus
2L 23513712 2L 14746825..14746974 667..517 565 92.7 Minus
2L 23513712 2L 14746994..14747075 512..431 365 96.3 Minus
X 23527363 X 13345603..13345637 93..59 160 97.1 Minus
Blast to na_te.dros performed on 2019-03-15 13:31:55 has no hits.

LD11847.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:32:54 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6709255..6709936 1..682 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:45:33 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 1..393 96..488 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:15 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 1..393 96..488 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:02:59 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 1..393 96..488 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:02 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 1..393 96..488 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:32:03 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 1..393 96..488 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:27 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 48..729 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:15 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 48..729 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:02:59 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 43..724 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:08 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 48..729 1..682 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:32:03 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Ab-RA 43..724 1..682 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:32:54 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10821718..10822399 1..682 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:32:54 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10821718..10822399 1..682 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:32:54 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10821718..10822399 1..682 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:02:59 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6709223..6709904 1..682 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:58 Download gff for LD11847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10822917..10823598 1..682 100   Plus

LD11847.hyp Sequence

Translation from 2 to 487

> LD11847.hyp
KYLRKFSSKGFFPFSRLRDGRVKQFWQTNPAMVRMNVLADALKCINNAEK
RGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNLTGRL
NKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRK
HLGGKILGFFF*

LD11847.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15Ab-PA 130 CG12324-PA 1..130 32..161 680 100 Plus
RpS15Aa-PF 130 CG2033-PF 1..130 32..161 670 97.7 Plus
RpS15Aa-PE 130 CG2033-PE 1..130 32..161 670 97.7 Plus
RpS15Aa-PD 130 CG2033-PD 1..130 32..161 670 97.7 Plus
RpS15Aa-PA 130 CG2033-PA 1..130 32..161 670 97.7 Plus

LD11847.pep Sequence

Translation from 95 to 487

> LD11847.pep
MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEF
EIVEDHRAGKIVVNLTGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFG
YVVLTTSGGIMDHEEARRKHLGGKILGFFF*

LD11847.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19502-PA 130 GF19502-PA 1..130 1..130 675 97.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19508-PA 130 GG19508-PA 1..130 1..130 675 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17815-PA 130 GH17815-PA 1..130 1..130 675 97.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15Ab-PA 130 CG12324-PA 1..130 1..130 680 100 Plus
RpS15Aa-PF 130 CG2033-PF 1..130 1..130 670 97.7 Plus
RpS15Aa-PE 130 CG2033-PE 1..130 1..130 670 97.7 Plus
RpS15Aa-PD 130 CG2033-PD 1..130 1..130 670 97.7 Plus
RpS15Aa-PA 130 CG2033-PA 1..130 1..130 670 97.7 Plus
RpS15Aa-PC 130 CG2033-PC 1..130 1..130 670 97.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16425-PA 130 GI16425-PA 1..130 1..130 675 97.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26726-PA 130 GL26726-PA 1..130 1..130 675 97.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15195-PA 130 GA15195-PA 1..130 1..130 675 97.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11496-PA 130 GM11496-PA 1..130 1..130 675 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15889-PA 130 GD15889-PA 1..130 1..130 675 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15828-PA 130 GJ15828-PA 1..130 1..130 675 97.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16027-PA 130 GK16027-PA 1..130 1..130 675 97.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS15Aa-PA 130 GE16163-PA 1..130 1..130 675 97.7 Plus