Clone LD11854 Report

Search the DGRC for LD11854

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:118
Well:54
Vector:pBS SK-
Associated Gene/TranscriptCG2656-RA
Protein status:LD11854.pep: gold
Preliminary Size:1208
Sequenced Size:1015

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2656 2001-01-01 Release 2 assignment
CG2656 2001-10-10 Blastp of sequenced clone
CG2656 2003-01-01 Sim4 clustering to Release 3
CG2656 2008-04-29 Release 5.5 accounting
CG2656 2008-08-15 Release 5.9 accounting
CG2656 2008-12-18 5.12 accounting

Clone Sequence Records

LD11854.complete Sequence

1015 bp (1015 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061137

> LD11854.complete
CACGCTATGCCTCACATTAGAATTTGTTTTGTTGCGGAATTTAGGTACTG
AAAATAACTTACGACTCATTATCATGCGGTTTGCCCAAATAATTGTGGGC
CCGGCAGGCAGTGGCAAGTCGACGTACTGCAGCTTAATGCAGCAATATGC
GATGGACTGCAAGAGAAATGTTCAGGTGGTGAACCTCGATCCGGCGGCAG
AGCACTTCACCTACAACCCGCTGACGGACATTCGCGATCTAATCCACCTG
GACGATGCCATGGAGGACGAAGAGCTGCACTACGGACCGAACGGCGGCCT
CATCTTCTGCCTGGAGTTCTTGATCGAGAACCAGGAATGGCTGAAGGAAC
AGCTCTGCGGCGGCGAGAACGAGCTGATGGTGGGCGAGCCGGATGATGAC
TACATCCTGTTCGACATGCCCGGCCAGATCGAGCTCTTCACTCACCTAAA
GATGGGCAGACAGCTGGTGGAACTGCTCGAGTCCTGGAACTTCCGCACAT
GCGTCGTCTTCTGCTTGGACTCGCAGTTCATGGTGGACGGGGCCAAGTTC
ATTTCCGGCACCATGGCCGCGCTCAGTGTGATGGCCAACATGGAGCAGCC
GCACATCAATGTGCTGACCAAAGTGGATCTGCTGAGCAGCGATGCGCGGA
AACAGCTGGAGATGTACCTGGAACCGGATGCCCACAGTCTGATGGGCGAG
CTGACCATCGGGACTGGTTTTGGCGAGAAATACGCAAAGCTTACGCAGGC
TATTGGCGCGCTAATTGAGGATTTCAGTTTGGTGAGATTTTTCCCGTTGG
ATTCCCAGGACGAGGAGAGCGTGGGCGATCTTCTGCTACAAATTGACAGT
ATCTTGCAGTACGGCGAGGATGCAGACGTGAACGTTAAGGACTTTGATGA
ACCGGAGGAAGGGGATCAGGATTGAAAAAAATCAATTTTTCATATTGCTT
AAGAAAATGTACAATATTTTATTTTTAATAAAAAATTAAATCTAATCAAA
AAAAAAAAAAAAAAA

LD11854.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG2656-RA 1033 CG2656-RA 28..1028 1..1001 5005 100 Plus
nc_15110.a 340 nc_15110.a 119..340 776..997 1110 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2970981..2971641 117..777 3305 100 Plus
chr3R 27901430 chr3R 2977117..2977339 775..997 1115 100 Plus
chr3R 27901430 chr3R 2970803..2970920 1..118 590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:58:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7144921..7145581 117..777 3305 100 Plus
3R 32079331 3R 7151048..7151274 775..1001 1135 100 Plus
3R 32079331 3R 7144743..7144860 1..118 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6885752..6886412 117..777 3305 100 Plus
3R 31820162 3R 6891879..6892105 775..1001 1135 100 Plus
3R 31820162 3R 6885574..6885691 1..118 590 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:27:41 has no hits.

LD11854.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:28:47 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2977120..2977300 778..958 100 -> Plus
chr3R 2970803..2970920 1..118 100 -> Plus
chr3R 2970983..2971641 119..777 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:45:36 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..852 74..925 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:11 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..852 74..925 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:53:06 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..852 74..925 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:54 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..852 74..925 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:41 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..852 74..925 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:08 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..997 1..997 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:10 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..997 1..997 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:06 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 20..1016 1..997 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:54 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 1..997 1..997 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:41 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
CG2656-RA 20..1016 1..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:47 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7144743..7144860 1..118 100 -> Plus
3R 7144923..7145581 119..777 100 -> Plus
3R 7151051..7151270 778..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:47 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7144743..7144860 1..118 100 -> Plus
3R 7144923..7145581 119..777 100 -> Plus
3R 7151051..7151270 778..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:47 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7144743..7144860 1..118 100 -> Plus
3R 7144923..7145581 119..777 100 -> Plus
3R 7151051..7151270 778..997 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:06 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2970465..2970582 1..118 100 -> Plus
arm_3R 2970645..2971303 119..777 100 -> Plus
arm_3R 2976773..2976992 778..997 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:50 Download gff for LD11854.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6885754..6886412 119..777 100 -> Plus
3R 6891882..6892101 778..997 100   Plus
3R 6885574..6885691 1..118 100 -> Plus

LD11854.hyp Sequence

Translation from 0 to 924

> LD11854.hyp
TLCLTLEFVLLRNLGTENNLRLIIMRFAQIIVGPAGSGKSTYCSLMQQYA
MDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEELHYGPNGGL
IFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLK
MGRQLVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQP
HINVLTKVDLLSSDARKQLEMYLEPDAHSLMGELTIGTGFGEKYAKLTQA
IGALIEDFSLVRFFPLDSQDEESVGDLLLQIDSILQYGEDADVNVKDFDE
PEEGDQD*

LD11854.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2656-PA 283 CG2656-PA 1..283 25..307 1482 100 Plus
CG10222-PB 307 CG10222-PB 15..282 26..294 399 36.7 Plus
CG10222-PA 307 CG10222-PA 15..282 26..294 399 36.7 Plus
CG3704-PA 382 CG3704-PA 27..228 30..235 215 30.7 Plus

LD11854.pep Sequence

Translation from 73 to 924

> LD11854.pep
MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPL
TDIRDLIHLDDAMEDEELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENE
LMVGEPDDDYILFDMPGQIELFTHLKMGRQLVELLESWNFRTCVVFCLDS
QFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQLEMYLE
PDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESV
GDLLLQIDSILQYGEDADVNVKDFDEPEEGDQD*

LD11854.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17656-PA 284 GF17656-PA 1..283 1..283 1381 89.4 Plus
Dana\GF10956-PA 307 GF10956-PA 15..282 2..270 409 37.4 Plus
Dana\GF22048-PA 380 GF22048-PA 27..197 6..186 227 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13875-PA 283 GG13875-PA 1..283 1..283 1458 96.1 Plus
Dere\GG13773-PA 307 GG13773-PA 15..282 2..270 412 36.5 Plus
Dere\GG12730-PA 379 GG12730-PA 27..197 6..186 234 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19007-PA 287 GH19007-PA 1..282 1..283 1350 88 Plus
Dgri\GH14681-PA 310 GH14681-PA 13..280 2..270 406 36.3 Plus
Dgri\GH19561-PA 385 GH19561-PA 31..201 6..186 211 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG2656-PA 283 CG2656-PA 1..283 1..283 1482 100 Plus
CG10222-PB 307 CG10222-PB 15..282 2..270 399 36.7 Plus
CG10222-PA 307 CG10222-PA 15..282 2..270 399 36.7 Plus
CG3704-PA 382 CG3704-PA 27..228 6..211 215 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23062-PA 289 GI23062-PA 1..278 1..278 1343 89.2 Plus
Dmoj\GI13090-PA 307 GI13090-PA 13..280 2..270 406 36 Plus
Dmoj\GI14999-PA 391 GI14999-PA 38..208 6..186 213 32 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12423-PA 286 GL12423-PA 1..283 1..283 1347 87.3 Plus
Dper\GL18533-PA 388 GL18533-PA 34..204 6..186 221 32 Plus
Dper\GL25435-PA 102 GL25435-PA 15..102 2..90 198 41.1 Plus
Dper\GL25436-PA 175 GL25436-PA 3..150 130..270 159 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15412-PA 286 GA15412-PA 1..283 1..283 1347 87.3 Plus
Dpse\GA28617-PA 307 GA28617-PA 15..282 2..270 410 36.7 Plus
Dpse\GA25677-PA 388 GA25677-PA 34..204 6..186 221 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10937-PA 283 GM10937-PA 1..283 1..283 1466 97.2 Plus
Dsec\GM24597-PA 307 GM24597-PA 15..282 2..270 416 36.8 Plus
Dsec\GM19010-PA 382 GM19010-PA 27..197 6..186 225 32 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19916-PA 283 GD19916-PA 1..283 1..283 1481 98.2 Plus
Dsim\GD12666-PA 266 GD12666-PA 15..145 2..140 266 42.1 Plus
Dsim\GD16449-PA 375 GD16449-PA 27..197 6..186 225 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24575-PA 201 GJ24575-PA 1..183 1..183 920 90.2 Plus
Dvir\GJ13838-PA 307 GJ13838-PA 13..280 2..270 412 36.3 Plus
Dvir\GJ15357-PA 399 GJ15357-PA 45..215 6..186 217 32.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14522-PA 284 GK14522-PA 1..283 1..283 1373 89 Plus
Dwil\GK17097-PA 307 GK17097-PA 15..282 2..270 421 36.1 Plus
Dwil\GK10172-PA 389 GK10172-PA 33..204 6..186 217 30.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24908-PA 283 GE24908-PA 1..283 1..283 1457 96.1 Plus
Dyak\GE20068-PA 307 GE20068-PA 15..282 2..270 409 35.8 Plus
Dyak\GE16556-PA 380 GE16556-PA 27..197 6..186 238 34.3 Plus