Clone LD12037 Report

Search the DGRC for LD12037

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:120
Well:37
Vector:pBS SK-
Associated Gene/Transcriptaph-1-RA
Protein status:LD12037.pep: gold
Preliminary Size:989
Sequenced Size:828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2855 2001-01-01 Release 2 assignment
CG2855 2003-01-01 Sim4 clustering to Release 3
CG2855 2003-01-13 Blastp of sequenced clone
aph-1 2008-04-29 Release 5.5 accounting
aph-1 2008-08-15 Release 5.9 accounting
aph-1 2008-12-18 5.12 accounting

Clone Sequence Records

LD12037.complete Sequence

828 bp (828 high quality bases) assembled on 2003-01-13

GenBank Submission: AY051658

> LD12037.complete
AGAAAAAACAGTAATAATACAAAGACAAGATGACGTTGCCCGAGTTCTTT
GGCTGCACCTTCATCGCCTTCGGACCGCCCTTCGCCTTGTTCGTCTTCAC
CATCGCCAATGATCCAGTGCGGATCATCATTCTGATTGCGGCGGCATTCT
TCTGGCTGCTTTCCCTGCTGATCTCTTCCCTGTGGTATGCCCTGATTCCG
CTGAAGGAGTTCCTGGCATTTGGCGTGGTCTTCTCGGTGTGCTTCCAGGA
AGCCTTCCGGTACATCATCTACCGGATACTGCGCAGCACGGAGCAGGGAT
TGCACGCCGTGGCGGAGGACACGCGAGTGACGGACAACAAGCACATCCTG
GCCTATGTCTCCGGCTTGGGATTCGGCATTATATCCGGGATGTTTGCACT
GGTCAATGTGCTGGCTGATATGAGTGGTCCCGGCACCATGGGCTTGAAGG
GCGGAACTGAGCTATTCTTCGTCACCTCGGCTGCCCAGGCGTTGTCGATT
ATCCTGCTGCACACCTTCTGGAGCGTTATTTTCTTCAACGCATTCGACAC
AAACAACTATATCCACATAGGCTATGTGGTTTTCAGCCACCTGTTCGTCT
CCCTGATAACTCTGCTCAATGCCAATGAGCTTTACACGACCACTCTGCTG
ATAAACTACTTGGTCACCATACTTACGGGAGTCCTGGCCTTCCGGGTGGC
TGGAGGAACATCTCGCAGTTTCAGAAAATTCATAACATGCCAGTAAACAT
ACTCCTAGTATTAACCGCCTAGTTAATAGCTTTTGTATAACATTATAAAA
AAAAACAAATAAAAAAAAAAAAAAAAAA

LD12037.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
aph-1-RA 1011 aph-1-RA 67..876 1..810 4050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2766007..2766428 1..422 2095 99.8 Plus
chr2L 23010047 chr2L 2766487..2766875 422..810 1945 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:59:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2766286..2766707 1..422 2110 100 Plus
2L 23513712 2L 2766766..2767154 422..810 1945 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2766286..2766707 1..422 2110 100 Plus
2L 23513712 2L 2766766..2767154 422..810 1945 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:02:56 has no hits.

LD12037.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:03:41 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2766007..2766428 1..422 99 -> Plus
chr2L 2766488..2766875 423..810 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:45:59 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 1..717 30..746 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:32 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 1..717 30..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:02 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 1..717 30..746 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:37 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 1..717 30..746 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:03 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 1..717 30..746 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:00 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 52..861 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:32 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 52..861 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:02 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 54..863 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:37 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 52..861 1..810 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:03 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
aph-1-RA 54..863 1..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:41 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2766286..2766707 1..422 100 -> Plus
2L 2766767..2767154 423..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:41 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2766286..2766707 1..422 100 -> Plus
2L 2766767..2767154 423..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:41 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2766286..2766707 1..422 100 -> Plus
2L 2766767..2767154 423..810 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:02 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2766286..2766707 1..422 100 -> Plus
arm_2L 2766767..2767154 423..810 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:10:49 Download gff for LD12037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2766767..2767154 423..810 100   Plus
2L 2766286..2766707 1..422 100 -> Plus

LD12037.pep Sequence

Translation from 29 to 745

> LD12037.pep
MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISS
LWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRV
TDNKHILAYVSGLGFGIISGMFALVNVLADMSGPGTMGLKGGTELFFVTS
AAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANE
LYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ*

LD12037.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13892-PA 239 GF13892-PA 1..239 1..238 1063 89.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24882-PA 238 GG24882-PA 1..238 1..238 1205 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13737-PA 239 GH13737-PA 1..239 1..238 1003 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
aph-1-PB 238 CG2855-PB 1..238 1..238 1212 100 Plus
aph-1-PA 238 CG2855-PA 1..238 1..238 1212 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17881-PA 239 GI17881-PA 1..239 1..238 969 81.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26582-PA 239 GL26582-PA 1..239 1..238 1051 88.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15487-PA 239 GA15487-PA 1..239 1..238 1055 88.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18364-PA 238 GM18364-PA 1..238 1..238 1209 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23180-PA 238 GD23180-PA 1..238 1..238 1214 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17382-PA 239 GJ17382-PA 1..239 1..238 1030 85.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24580-PA 239 GK24580-PA 1..239 1..238 1057 88.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18179-PA 238 GE18179-PA 1..238 1..238 1209 99.2 Plus

LD12037.hyp Sequence

Translation from 29 to 745

> LD12037.hyp
MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISS
LWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRV
TDNKHILAYVSGLGFGIISGMFALVNVLADMSGPGTMGLKGGTELFFVTS
AAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANE
LYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ*

LD12037.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
aph-1-PB 238 CG2855-PB 1..238 1..238 1212 100 Plus
aph-1-PA 238 CG2855-PA 1..238 1..238 1212 100 Plus