Clone LD12153 Report

Search the DGRC for LD12153

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:121
Well:53
Vector:pBS SK-
Associated Gene/TranscriptDph5-RA
Protein status:LD12153.pep: gold
Preliminary Size:1338
Sequenced Size:1156

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5275 2001-01-01 Release 2 assignment
CG31289 2002-11-12 Blastp of sequenced clone
CG31289 2003-01-01 Sim4 clustering to Release 3
Dph5 2008-04-29 Release 5.5 accounting
Dph5 2008-08-15 Release 5.9 accounting
Dph5 2008-12-18 5.12 accounting

Clone Sequence Records

LD12153.complete Sequence

1156 bp (1156 high quality bases) assembled on 2002-11-12

GenBank Submission: AF160929

> LD12153.complete
CGGCGGTCACACAACGCGCGACGGCACGTGTTGACTGCATTTAAAAAGCG
ATTTTAATAACATTTGGCAGGAGTTGCAGTGGCCGAGCAGTCGCACCAGT
CGCCCAGCATGTTCTACCTAATCGGCCTCGGCCTTGGCGACCTGAAGGAC
ATCACGGTCAAGGGTCTGGAGATAGTGAAGCAATGCAGTCGCGTCTATCT
GGAGATGTACACCTCGATTCTGGGCTGCAGCCTTGAGGATATGCAAGAGT
TCTATGGACGACCACTGCTGCTAGCCGACCGCGATCTGGTGGAGCAGGGT
GCGGATGAGATCCTGGCGGGTGCGGGCGAATCCGATGTTGCGCTGCTCGT
GGTGGGCGACCCCTTTGGCGCCACCACCCACACAGACTTCATACTGCGCG
CCAAGGAGAAGAACATCCCCTACAAGGTCATCCACAATGCATCGATCATG
AACGCCGTCGGCTGCTGCGGCCTGCAATTGTACAAATTCGGCGAGACCGT
TTCGATTCCGTACTGGGACGAGACATGGAAGCCGGACAGCTTCTACGACA
AGATCAAGCTGAATCGCCTGCACAACATGCACACGCTGTGCCTGCTGGAC
ATCAAGGTGAAGGAGCCCACGCCGGAGTCCTTGATGCGCAAACGCAAGGA
GTACATGCCACCGCGTTTCATGACCGTGGCGGAGGCGGCTCATCAGTTGC
TGTCCATTGTGGAGAAGAAGGACTCGCTGGAGAAGAACACAGTGCTCAAC
GAGCAGTCACTGTGCGTTGGACTGGCCCGTGTTGGCCAGGAGTCGCAGCA
GATTGCCGTTGGCACGCTGCTTGAGATGCGCTCGACCGATTTGGGCGGAC
CGCTGCACTCGCTCATCATTCCCGCCAAGGAGATGCATCCGCTGGAGGTG
GAGTTCTTGCAGCAGTATGCCCCCAGCATCAAGCTGGACGACTACAACCA
CTAATTCCGCTGCGAAATTACCTAATTTAGTGTCTAGGAAATGTTGTCTG
TGCATCTGAATTGAATTTACGAAGCAAGAGGAGCTGGAAGCTCAGGAAGA
AAGTGATATCGCTTGATGCCACCCGTATACGTATGTAGCCTGCCCAGCGG
CAGCTGAAATAAAACCGCATTCACCCATCGTAAAAAAAAAAAAAAAAAAA
AAAAAA

LD12153.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dph5-RA 1240 Dph5-RA 56..1187 1..1132 5660 100 Plus
CSN6-RA 1299 CSN6-RA 1258..1299 1132..1091 210 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18405564..18406452 1131..243 4415 99.8 Minus
chr3R 27901430 chr3R 18406522..18406764 243..1 1215 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:59:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22582027..22582916 1132..243 4450 100 Minus
3R 32079331 3R 22582986..22583228 243..1 1215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22322858..22323747 1132..243 4450 100 Minus
3R 31820162 3R 22323817..22324059 243..1 1215 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:50:05 has no hits.

LD12153.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:50:47 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18405564..18406451 244..1131 99 <- Minus
chr3R 18406522..18406764 1..243 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:46:06 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..846 109..954 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:09 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..846 109..954 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:43:01 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..846 109..954 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:16 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..846 109..954 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:18:10 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..846 109..954 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:36 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..1131 1..1131 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:08 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..1131 1..1131 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:43:01 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..1128 4..1131 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:16 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..1131 1..1131 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:18:10 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
Dph5-RA 1..1128 4..1131 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:47 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22582028..22582915 244..1131 100 <- Minus
3R 22582986..22583228 1..243 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:47 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22582028..22582915 244..1131 100 <- Minus
3R 22582986..22583228 1..243 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:47 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22582028..22582915 244..1131 100 <- Minus
3R 22582986..22583228 1..243 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:43:01 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18407750..18408637 244..1131 100 <- Minus
arm_3R 18408708..18408950 1..243 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:37 Download gff for LD12153.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22322859..22323746 244..1131 100 <- Minus
3R 22323817..22324059 1..243 100   Minus

LD12153.pep Sequence

Translation from 108 to 953

> LD12153.pep
MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYG
RPLLLADRDLVEQGADEILAGAGESDVALLVVGDPFGATTHTDFILRAKE
KNIPYKVIHNASIMNAVGCCGLQLYKFGETVSIPYWDETWKPDSFYDKIK
LNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEAAHQLLSI
VEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLH
SLIIPAKEMHPLEVEFLQQYAPSIKLDDYNH*

LD12153.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16145-PA 281 GF16145-PA 1..281 1..281 1483 98.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12504-PA 281 GG12504-PA 1..281 1..281 1493 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18052-PA 281 GH18052-PA 1..281 1..281 1417 92.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dph5-PA 281 CG31289-PA 1..281 1..281 1461 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10523-PA 281 GI10523-PA 1..281 1..281 1434 94.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13679-PA 281 GL13679-PA 1..281 1..281 1464 96.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16151-PA 281 GA16151-PA 1..281 1..281 1461 95.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23636-PA 281 GM23636-PA 1..281 1..281 1487 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18446-PA 281 GD18446-PA 1..281 1..281 1493 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24174-PA 281 GJ24174-PA 1..281 1..281 1422 93.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11785-PA 281 GK11785-PA 1..281 1..281 1447 95.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Dph5-PA 281 GE24024-PA 1..281 1..281 1493 99.6 Plus

LD12153.hyp Sequence

Translation from 108 to 953

> LD12153.hyp
MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYG
RPLLLADRDLVEQGADEILAGAGESDVALLVVGDPFGATTHTDFILRAKE
KNIPYKVIHNASIMNAVGCCGLQLYKFGETVSIPYWDETWKPDSFYDKIK
LNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEAAHQLLSI
VEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLH
SLIIPAKEMHPLEVEFLQQYAPSIKLDDYNH*

LD12153.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dph5-PA 281 CG31289-PA 1..281 1..281 1461 100 Plus