Clone LD12305 Report

Search the DGRC for LD12305

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:123
Well:5
Vector:pBS SK-
Associated Gene/TranscriptCG4115-RA
Protein status:LD12305.pep: gold
Sequenced Size:1117

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4115 2008-04-29 Release 5.5 accounting
CG4115 2008-04-29 Picked prior to 5.5
CG4115 2008-08-15 Release 5.9 accounting
CG4115 2008-12-18 5.12 accounting

Clone Sequence Records

LD12305.complete Sequence

1117 bp assembled on 2007-07-18

GenBank Submission: BT030988

> LD12305.complete
ATCAGTGCCAGCCGATCGGTCGGTAGAGAGAAGTGCGTCGCGAGTCCAAA
AAAGAAAATCGAGCCCGCAGAAAGTGCCAGTGAATAGACTGATAAAGCAA
ACAAAAATGAAAGCTTTCATTATCGCCGGAGTGTGCGTGTTGAGCGTGCT
GAGCCTGGGATCCGCTCAGTTCCAGAACGGACGTCTGGAGCCGCCGAATC
CGCAGCTCTGTGCCCAGCGTGTCATTCACGAGAAGACTCCCGATGGCAAG
GGTTACTTCTTCTCGTGGCGCGACCCTCAGCTGAAGGGCGTGGAGGAGGA
CTGGCTGACCGCCAGGAACTACTGCCGCAGGCGCTGCATGGACTCCGTTT
CCCTGGAGACCAGTTTGGAGAACGAGTGGATCAAGCAGTATGTTGTGCGC
GAGAATGTGAAATACATCTGGACCAGCGGCCGCTTGTGTGACTTCAAGGG
CTGTGACCGCCCCGATCTGCAGCCCACAAACATCAACGGTTGGTTCTGGA
CCGCCACACTGCAGAAACTGGCACCAACCACTGAGAGGAACCAGGGCGAT
TGGTCGCCCACCGGAGGCATTGGCCTGCCCCAGCCGGACAACCGCGAGTA
CAAGCAGAATGGAGCGCCGGAGAATTGTCTCGCCCTGCTGAATCAGTTCT
ACAACGATGGCGTAAACTGGCACGATGTGGCATGCCATCACAAGAAGAGC
TTCGTCTGCGAGGAGAACGATGCTCTGCTGAAGTATGTGCGCTACACGAA
CCCCAATCTGCGCATCTAAGAGGATCGCGATCAGGATCAGAATCCGAATG
CGAATGTGGGCTGGCGGAAGGACCAGCGACACTCTCCAAGTAAAACCAAA
AATGATATTTCCCAAATCGGCAGCGGGAACGATGATCGATGTCAACTATA
TGTCTAATCTCCGATTGTCTTTGAATGCAAAGTTTTCTGGCCAAATTGCT
GCATGATATACTTACTTATGAACCCTATCCTGGTAACCACCTTCCAATTC
TCTGCGCTCTGTTCTGTCTCATCAACTAGTTTAATTCTTAATTTTGTATT
AATTTATGATTTTCTTTAATTATAATAAAAGATTCGAAACGATTTTGATA
AAAAAAAAAAAAAAAAA

LD12305.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4115-RA 1208 CG4115-RA 24..1124 1..1101 5505 100 Plus
CG6055.b 982 CG6055.b 219..288 291..360 185 84.2 Plus
CG6055.a 1031 CG6055.a 268..337 291..360 185 84.2 Plus
CG6055.b 982 CG6055.b 572..682 647..757 180 77.4 Plus
CG6055.a 1031 CG6055.a 621..731 647..757 180 77.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8187940..8188632 407..1099 3450 99.9 Plus
chr3R 27901430 chr3R 8185401..8185652 1..252 1260 100 Plus
chr3R 27901430 chr3R 8185713..8185869 252..408 770 99.4 Plus
chr2L 23010047 chr2L 7470777..7470846 291..360 185 84.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
snmRNA:419-RA 74 CR33917-RA 1..74 760..833 370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12362563..12363257 407..1101 3475 100 Plus
3R 32079331 3R 12360024..12360275 1..252 1260 100 Plus
3R 32079331 3R 12360336..12360492 252..408 785 100 Plus
2L 23513712 2L 7471730..7471799 291..360 185 84.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12103394..12104088 407..1101 3475 100 Plus
3R 31820162 3R 12100855..12101106 1..252 1260 100 Plus
3R 31820162 3R 12101167..12101323 252..408 785 100 Plus
2L 23513712 2L 7471730..7471799 291..360 185 84.2 Plus
2L 23513712 2L 7472083..7472193 647..757 180 77.4 Plus
Blast to na_te.dros performed 2019-03-16 05:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3817..3889 1099..1022 126 66.7 Minus

LD12305.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:37:34 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8185401..8185652 1..252 100 -> Plus
chr3R 8185714..8185867 253..406 99 -> Plus
chr3R 8187940..8188562 407..1029 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:46:12 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 1..663 107..769 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:01 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 1..663 107..769 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:28:32 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 1..663 107..769 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:10:48 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 1..663 107..769 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:06:46 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 1..663 107..769 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:59:19 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
snmRNA:419-RA 1..74 760..833 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:31:33 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 14..1110 1..1097 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:01 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 14..1110 1..1097 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:32 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 14..1110 1..1097 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:10:48 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 14..1110 1..1097 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:06:46 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
CG4115-RA 17..1115 1..1099 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:34 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12360024..12360275 1..252 100 -> Plus
3R 12360337..12360490 253..406 100 -> Plus
3R 12362563..12363255 407..1099 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:34 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12360024..12360275 1..252 100 -> Plus
3R 12360337..12360490 253..406 100 -> Plus
3R 12362563..12363255 407..1099 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:34 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12360024..12360275 1..252 100 -> Plus
3R 12360337..12360490 253..406 100 -> Plus
3R 12362563..12363255 407..1099 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:32 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8186059..8186212 253..406 100 -> Plus
arm_3R 8185746..8185997 1..252 100 -> Plus
arm_3R 8188285..8188977 407..1099 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:14 Download gff for LD12305.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12101168..12101321 253..406 100 -> Plus
3R 12100855..12101106 1..252 100 -> Plus
3R 12103394..12104086 407..1099 100   Plus

LD12305.hyp Sequence

Translation from 0 to 768

> LD12305.hyp
SVPADRSVERSASRVQKRKSSPQKVPVNRLIKQTKMKAFIIAGVCVLSVL
SLGSAQFQNGRLEPPNPQLCAQRVIHEKTPDGKGYFFSWRDPQLKGVEED
WLTARNYCRRRCMDSVSLETSLENEWIKQYVVRENVKYIWTSGRLCDFKG
CDRPDLQPTNINGWFWTATLQKLAPTTERNQGDWSPTGGIGLPQPDNREY
KQNGAPENCLALLNQFYNDGVNWHDVACHHKKSFVCEENDALLKYVRYTN
PNLRI*

LD12305.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4115-PA 220 CG4115-PA 1..220 36..255 1228 100 Plus
CG6055-PB 219 CG6055-PB 22..219 61..255 666 59.3 Plus
CG6055-PA 219 CG6055-PA 22..219 61..255 666 59.3 Plus
Clect27-PB 231 CG3244-PB 10..231 39..255 498 44.4 Plus
Clect27-PA 231 CG3244-PA 10..231 39..255 498 44.4 Plus

LD12305.pep Sequence

Translation from 106 to 768

> LD12305.pep
MKAFIIAGVCVLSVLSLGSAQFQNGRLEPPNPQLCAQRVIHEKTPDGKGY
FFSWRDPQLKGVEEDWLTARNYCRRRCMDSVSLETSLENEWIKQYVVREN
VKYIWTSGRLCDFKGCDRPDLQPTNINGWFWTATLQKLAPTTERNQGDWS
PTGGIGLPQPDNREYKQNGAPENCLALLNQFYNDGVNWHDVACHHKKSFV
CEENDALLKYVRYTNPNLRI*

LD12305.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17242-PA 220 GF17242-PA 1..220 1..220 1161 96.8 Plus
Dana\GF15862-PA 219 GF15862-PA 22..219 26..220 638 58.8 Plus
Dana\GF14419-PA 231 GF14419-PA 34..231 27..220 482 48.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18750-PA 220 GG18750-PA 1..220 1..220 1174 98.6 Plus
Dere\GG10482-PA 219 GG10482-PA 6..219 11..220 652 56.3 Plus
Dere\GG24353-PA 231 GG24353-PA 7..231 1..220 481 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22097-PA 220 GH22097-PA 1..220 1..220 1137 94.1 Plus
Dgri\GH11170-PA 219 GH11170-PA 2..219 4..220 652 54.8 Plus
Dgri\GH10241-PA 190 GH10241-PA 36..188 27..175 318 45.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4115-PA 220 CG4115-PA 1..220 1..220 1228 100 Plus
CG6055-PB 219 CG6055-PB 22..219 26..220 666 59.3 Plus
CG6055-PA 219 CG6055-PA 22..219 26..220 666 59.3 Plus
Clect27-PB 231 CG3244-PB 10..231 4..220 498 44.4 Plus
Clect27-PA 231 CG3244-PA 10..231 4..220 498 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22702-PA 220 GI22702-PA 1..220 1..220 1145 95 Plus
Dmoj\GI23788-PA 219 GI23788-PA 2..219 4..220 652 54.3 Plus
Dmoj\GI15343-PA 233 GI15343-PA 36..233 27..220 487 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22277-PA 220 GL22277-PA 1..220 1..220 1153 95.9 Plus
Dper\GL25820-PA 219 GL25820-PA 22..219 26..220 652 59.8 Plus
Dper\GL15967-PA 232 GL15967-PA 35..232 27..220 478 47.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17968-PA 220 GA17968-PA 1..220 1..220 1153 95.9 Plus
Dpse\GA19326-PA 219 GA19326-PA 22..219 26..220 652 59.8 Plus
Dpse\GA16905-PA 246 GA16905-PA 49..246 27..220 481 47.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24013-PA 220 GM24013-PA 1..220 1..220 1189 100 Plus
Dsec\GM16469-PA 219 GM16469-PA 6..219 11..220 654 56.3 Plus
Dsec\GM18074-PA 231 GM18074-PA 7..231 1..220 480 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18814-PA 220 GD18814-PA 1..220 1..220 1189 100 Plus
Dsim\GD23474-PA 219 GD23474-PA 6..219 11..220 650 56.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23431-PA 220 GJ23431-PA 1..220 1..220 1140 94.5 Plus
Dvir\GJ21003-PA 219 GJ21003-PA 2..219 4..220 653 54.8 Plus
Dvir\GJ17272-PA 233 GJ17272-PA 36..233 27..220 480 48.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11972-PA 220 GK11972-PA 1..220 1..220 1141 95 Plus
Dwil\GK24308-PA 219 GK24308-PA 2..219 4..220 652 55.4 Plus
Dwil\GK23915-PA 233 GK23915-PA 7..233 4..220 490 44.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26172-PA 220 GE26172-PA 1..220 1..220 1188 99.5 Plus
Dyak\GE14572-PA 219 GE14572-PA 6..219 11..220 650 56.3 Plus
Dyak\GE14680-PA 231 GE14680-PA 7..231 1..220 481 43.8 Plus