Clone LD12613 Report

Search the DGRC for LD12613

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:126
Well:13
Vector:pBS SK-
Associated Gene/TranscriptCpr62Bc-RA
Protein status:LD12613.pep: gold
Preliminary Size:1119
Sequenced Size:1014

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1919 2001-01-01 Release 2 assignment
CG1919 2001-10-10 Blastp of sequenced clone
CG1919 2003-01-01 Sim4 clustering to Release 3
Cpr62Bc 2008-04-29 Release 5.5 accounting
Cpr62Bc 2008-08-15 Release 5.9 accounting
Cpr62Bc 2008-12-18 5.12 accounting

Clone Sequence Records

LD12613.complete Sequence

1014 bp (1014 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061158

> LD12613.complete
CTCAACGTACAGCACACACTCGCGTCTGCAAGAAACAAAATCCCAAAAAT
CCAAACAATGGCATTCTTCAAATCCCTCATCTGCCTGGCCGTCCTGAGCG
CCGCCTCCGCCGGAGTCCTCCACGGACATGGTGCTGGTCTCTACGCCGCC
GCCCCGGCCATCTATGCCGGCCATGGTCACCACGACGAGGGAATCGATTA
CCATGCCTACCCCAAGTACCACTACAACTACGGAGTGGCTGACTCTCACA
CCGGAGACGTGAAGTCGCAGCACGAAGTGCGTGATGGTGATGTCGTCAAG
GGATCCTACTCTCTGGTGGAGCCCGATGGTTCGGTGCGCACCGTGGAGTA
CACCGCCGATGACCACAATGGCTTCAACGCCGTCGTCCACAAGACCGGCC
CCACTGTGCACCACGCCGCTCCCGCTGTGGTTGCCCACGCCGCTCCCGCC
GTGGTCCATGCCGCTCCGGCCTATGCCCCAGCCATTGCCCACCATGTGGC
CGCCGCTCCCGCCGTGCCCTACGCCGGATCCCTGGCGCATCAGGTGCCCG
CCTACGGATACGCCACCCACAACGCTCACGCGCATGTGGCCCACTACTAA
GGAAGTGGAGCAGTCCGCTGGATGCACCACCTGAAGCACCACCTGCACCG
CTAACACCACTCTTCTGTAATTTATTAAGCACGTTGACGACCTCACAAAA
CGGCTGATCGATCCACTGACGAAGCCTGCTAAAATACTCAGTACCACAGT
CATGTCCATCATGTCCTGCCGTGGATTCCCCGGACTTTCCCGGCAGCCTC
TGTCTCCCTCACACACACACACACACATTGCCGTCTCTGTCTCAGCTTTC
GCGCAATTCTCTCTTTTGTTTGTTAATCAACCTTCTCTTTAATTGTAAAT
AATGAAAACATCGAGTGAGGAACAAACGCCCATCCTGCCACACGCCCACG
AAGAAGAACCAACCTGAAAAGATGAAGAAAAACGAACAAAATGTAAAAAA
AAAAAAAAAAAAAA

LD12613.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr62Bc-RA 1314 Cpr62Bc-RA 198..1211 1..1014 5040 99.8 Plus
Cpr66Cb-RA 1122 Cpr66Cb-RA 447..619 225..397 445 83.8 Plus
CG34461-RA 806 CG34461-RA 473..629 247..403 440 85.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1839928..1840717 994..205 3815 98.9 Minus
chr3L 24539361 chr3L 1841297..1841429 205..73 650 99.2 Minus
chr3L 24539361 chr3L 8329973..8330145 225..397 445 83.8 Plus
chr3L 24539361 chr3L 8318897..8318994 307..404 385 92.9 Plus
chr3L 24539361 chr3L 1841527..1841598 72..1 360 100 Minus
chr3L 24539361 chr3L 4210483..4210575 360..268 210 81.7 Minus
chr3L 24539361 chr3L 4215409..4215461 280..332 190 90.6 Plus
chr3L 24539361 chr3L 19509478..19509515 343..380 190 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:59:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1840378..1841187 1014..205 4020 99.8 Minus
3L 28110227 3L 1841760..1841892 205..73 665 100 Minus
3L 28110227 3L 8337932..8338104 225..397 445 83.8 Plus
3L 28110227 3L 8326842..8326938 307..403 380 92.8 Plus
3L 28110227 3L 1841990..1842061 72..1 360 100 Minus
3L 28110227 3L 4211097..4211189 360..268 210 81.7 Minus
3L 28110227 3L 4216023..4216075 280..332 190 90.6 Plus
3L 28110227 3L 19520076..19520113 343..380 190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1840378..1841187 1014..205 4020 99.7 Minus
3L 28103327 3L 1841760..1841892 205..73 665 100 Minus
3L 28103327 3L 8331032..8331204 225..397 445 83.8 Plus
3L 28103327 3L 8319942..8320038 307..403 380 92.7 Plus
3L 28103327 3L 1841990..1842061 72..1 360 100 Minus
3L 28103327 3L 4211097..4211189 360..268 210 81.7 Minus
3L 28103327 3L 19513176..19513213 343..380 190 100 Plus
3L 28103327 3L 4216023..4216075 280..332 190 90.5 Plus
Blast to na_te.dros performed on 2019-03-16 15:12:10 has no hits.

LD12613.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:12:47 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1839928..1840717 205..994 98 <- Minus
chr3L 1841298..1841429 73..204 99 <- Minus
chr3L 1841527..1841598 1..72 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:46:34 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 1..543 58..600 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:17 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 1..543 58..600 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:28 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 1..543 58..600 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:03 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 1..543 58..600 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:22 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 1..543 58..600 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:29 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 20..1013 1..994 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:16 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 20..1013 1..994 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:28 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 24..1017 1..994 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:04 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 20..1013 1..994 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:22 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bc-RA 24..1017 1..994 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:47 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1841761..1841892 73..204 100 <- Minus
3L 1841990..1842061 1..72 100   Minus
3L 1840398..1841187 205..994 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:47 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1841761..1841892 73..204 100 <- Minus
3L 1841990..1842061 1..72 100   Minus
3L 1840398..1841187 205..994 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:47 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1841761..1841892 73..204 100 <- Minus
3L 1841990..1842061 1..72 100   Minus
3L 1840398..1841187 205..994 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:28 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1840398..1841187 205..994 100 <- Minus
arm_3L 1841761..1841892 73..204 100 <- Minus
arm_3L 1841990..1842061 1..72 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:00 Download gff for LD12613.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1840398..1841187 205..994 100 <- Minus
3L 1841761..1841892 73..204 100 <- Minus
3L 1841990..1842061 1..72 100   Minus

LD12613.hyp Sequence

Translation from 0 to 599

> LD12613.hyp
LNVQHTLASARNKIPKIQTMAFFKSLICLAVLSAASAGVLHGHGAGLYAA
APAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVK
GSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVHHAAPAVVAHAAPA
VVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPAYGYATHNAHAHVAHY*

LD12613.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr62Bc-PB 180 CG1919-PB 1..180 20..199 972 100 Plus
Cpr62Bc-PA 180 CG1919-PA 1..180 20..199 972 100 Plus
CG34461-PB 138 CG34461-PB 2..138 24..165 359 54.7 Plus
CG34461-PA 138 CG34461-PA 2..138 24..165 359 54.7 Plus
Cpr62Bb-PC 194 CG13935-PC 3..194 25..199 355 42.6 Plus

LD12613.pep Sequence

Translation from 57 to 599

> LD12613.pep
MAFFKSLICLAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYHA
YPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTA
DDHNGFNAVVHKTGPTVHHAAPAVVAHAAPAVVHAAPAYAPAIAHHVAAA
PAVPYAGSLAHQVPAYGYATHNAHAHVAHY*

LD12613.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24956-PA 188 GF24956-PA 1..188 1..180 701 91.5 Plus
Dana\GF24957-PA 189 GF24957-PA 3..132 6..153 315 52.7 Plus
Dana\GF10288-PA 157 GF10288-PA 49..145 13..115 314 64.1 Plus
Dana\GF10287-PA 375 GF10287-PA 43..109 50..116 303 82.1 Plus
Dana\GF23679-PA 196 GF23679-PA 63..148 36..118 279 67.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14555-PA 180 GG14555-PA 1..180 1..180 870 98.9 Plus
Dere\GG14556-PA 228 GG14556-PA 3..127 6..148 314 53.1 Plus
Dere\GG14302-PA 162 GG14302-PA 77..150 42..115 307 78.4 Plus
Dere\GG16039-PA 198 GG16039-PA 81..157 49..121 267 68.8 Plus
Dere\GG14206-PA 148 GG14206-PA 29..147 1..132 257 48.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15041-PA 182 GH15041-PA 1..182 1..180 590 77.1 Plus
Dgri\GH15054-PA 167 GH15054-PA 52..149 13..115 304 62.1 Plus
Dgri\GH15042-PA 191 GH15042-PA 3..120 6..137 298 51.1 Plus
Dgri\GH15052-PA 136 GH15052-PA 48..135 50..145 295 65.6 Plus
Dgri\GH17178-PA 200 GH17178-PA 74..160 36..118 247 62.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr62Bc-PB 180 CG1919-PB 1..180 1..180 972 100 Plus
Cpr62Bc-PA 180 CG1919-PA 1..180 1..180 972 100 Plus
CG34461-PB 138 CG34461-PB 2..138 5..146 359 54.7 Plus
CG34461-PA 138 CG34461-PA 2..138 5..146 359 54.7 Plus
Cpr62Bb-PC 194 CG13935-PC 3..194 6..180 355 42.6 Plus
Cpr62Bb-PB 194 CG13935-PB 3..194 6..180 355 42.6 Plus
Cpr62Bb-PA 194 CG13935-PA 3..194 6..180 355 42.6 Plus
Cpr66Cb-PA 162 CG7076-PA 54..154 17..119 349 66.3 Plus
Ccp84Ab-PA 221 CG1252-PA 3..202 4..180 313 41.3 Plus
Ccp84Aa-PA 205 CG2360-PA 3..197 4..178 306 40.8 Plus
Ccp84Ad-PA 199 CG2341-PA 3..199 4..180 295 39.8 Plus
Cpr76Bb-PA 198 CG9290-PA 56..155 19..119 286 55.7 Plus
Cpr92A-PA 245 CG6240-PA 9..199 11..178 282 42.1 Plus
Cpr64Aa-PA 192 CG15006-PA 7..177 7..169 280 42.1 Plus
Ccp84Ac-PA 217 CG1327-PA 1..216 1..179 269 38 Plus
Cpr64Ad-PB 247 CG1259-PB 142..247 50..165 249 50.9 Plus
Ccp84Af-PA 151 CG1331-PA 3..151 4..146 245 44.2 Plus
Edg84A-PA 188 CG2345-PA 13..182 27..179 243 38.7 Plus
Cpr31A-PA 340 CG33302-PA 100..223 12..151 241 46.4 Plus
Cpr64Ab-PA 120 CG15007-PA 1..117 1..130 239 48.9 Plus
Ccp84Ag-PA 191 CG2342-PA 1..159 1..156 238 40.9 Plus
Cpr5C-PA 145 CG4052-PA 3..141 4..140 237 46.7 Plus
Cpr64Ac-PA 188 CG15008-PA 86..183 48..144 234 51 Plus
Cpr76Ba-PA 204 CG9283-PA 59..164 12..118 231 46.8 Plus
Ccp84Ae-PA 208 CG1330-PA 4..146 5..152 231 44.6 Plus
Cpr76Bc-PD 424 CG9295-PD 42..120 43..118 227 57 Plus
Cpr76Bc-PC 424 CG9295-PC 42..120 43..118 227 57 Plus
Crys-PB 477 CG16963-PB 70..135 47..112 218 63.6 Plus
Crys-PA 477 CG16963-PA 70..135 47..112 218 63.6 Plus
Cpr30F-PA 146 CG31876-PA 37..146 46..146 217 45.5 Plus
Cpr35B-PA 218 CG3474-PA 5..139 3..121 214 40.4 Plus
Cpr76Bd-PD 1228 CG9299-PD 1079..1209 10..110 214 42.9 Plus
Cpr76Bd-PB 1228 CG9299-PB 1079..1209 10..110 214 42.9 Plus
Cpr76Bd-PC 1231 CG9299-PC 1082..1212 10..110 214 42.9 Plus
Cpr23B-PA 302 CG2973-PA 157..228 54..129 199 55.3 Plus
CG13670-PA 266 CG13670-PA 90..168 41..119 192 46.8 Plus
CG42367-PC 103 CG42367-PC 13..97 28..112 178 49.4 Plus
Cpr30B-PA 153 CG3818-PA 33..130 54..160 177 39.3 Plus
Cpr92F-PA 381 CG5494-PA 29..158 49..176 165 37.8 Plus
Cpr66D-PA 270 CG32029-PA 158..214 54..110 149 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12933-PA 163 GI12933-PA 1..163 1..180 636 78.5 Plus
Dmoj\GI11675-PA 176 GI11675-PA 1..176 1..180 557 75 Plus
Dmoj\GI11676-PA 187 GI11676-PA 3..138 6..155 318 50.3 Plus
Dmoj\GI12820-PA 164 GI12820-PA 52..155 13..121 311 60.6 Plus
Dmoj\GI12819-PA 389 GI12819-PA 64..129 50..115 306 83.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24822-PA 183 GL24822-PA 1..183 1..180 708 86.4 Plus
Dper\GL24694-PA 159 GL24694-PA 51..147 13..115 322 64.1 Plus
Dper\GL24692-PA 133 GL24692-PA 45..132 50..145 308 67.7 Plus
Dper\GL24824-PA 195 GL24824-PA 3..157 6..154 302 45.3 Plus
Dper\GL20937-PA 198 GL20937-PA 81..146 49..114 258 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15131-PA 183 GA15131-PA 1..183 1..180 724 88 Plus
Dpse\GA20083-PA 159 GA20083-PA 51..147 13..115 322 64.1 Plus
Dpse\GA23954-PA 133 GA23954-PA 45..132 50..145 308 67.7 Plus
Dpse\GA12639-PA 195 GA12639-PA 3..157 6..154 302 45.3 Plus
Dpse\GA21674-PA 198 GA21674-PA 81..146 49..114 258 74.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14163-PA 180 GM14163-PA 1..180 1..180 879 100 Plus
Dsec\GM25044-PA 162 GM25044-PA 50..150 13..115 314 64.8 Plus
Dsec\GM14164-PA 225 GM14164-PA 3..127 6..148 313 52.4 Plus
Dsec\GM19580-PA 198 GM19580-PA 67..157 40..121 267 62.6 Plus
Dsec\GM13998-PA 147 GM13998-PA 28..146 1..132 262 48.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13434-PA 180 GD13434-PA 1..180 1..180 875 99.4 Plus
Dsim\GD17606-PA 192 GD17606-PA 3..127 6..148 317 52.4 Plus
Dsim\GD14078-PA 177 GD14078-PA 40..177 2..146 314 53.7 Plus
Dsim\GD14081-PA 162 GD14081-PA 50..150 13..115 313 64.8 Plus
Dsim\GD14807-PA 198 GD14807-PA 67..157 40..121 269 63.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12945-PA 178 GJ12945-PA 1..178 1..180 656 85.9 Plus
Dvir\GJ12961-PA 135 GJ12961-PA 47..129 50..135 307 72.1 Plus
Dvir\GJ12963-PA 164 GJ12963-PA 52..149 13..115 301 62.1 Plus
Dvir\GJ12946-PA 185 GJ12946-PA 3..99 6..118 298 55.8 Plus
Dvir\GJ13494-PA 198 GJ13494-PA 70..144 38..114 253 70.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20563-PA 184 GK20563-PA 1..184 1..180 693 79.9 Plus
Dwil\GK20564-PA 195 GK20564-PA 3..136 6..153 312 50.3 Plus
Dwil\GK11910-PA 389 GK11910-PA 47..112 50..115 307 83.3 Plus
Dwil\GK11921-PA 158 GK11921-PA 72..146 41..115 304 77.3 Plus
Dwil\GK12249-PA 228 GK12249-PA 3..165 4..153 251 44.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20909-PA 180 GE20909-PA 1..180 1..180 879 100 Plus
Dyak\GE20730-PA 162 GE20730-PA 50..150 13..115 314 64.8 Plus
Dyak\GE20910-PA 229 GE20910-PA 3..127 6..148 314 53.1 Plus
Dyak\GE19605-PA 195 GE19605-PA 66..154 40..121 266 64 Plus
Dyak\GE20635-PA 120 GE20635-PA 1..119 1..132 259 48.1 Plus