Clone LD12690 Report

Search the DGRC for LD12690

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:126
Well:90
Vector:pBS SK-
Associated Gene/Transcriptpoly-RA
Protein status:LD12690.pep: gold
Preliminary Size:1233
Sequenced Size:1140

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9829 2001-01-01 Release 2 assignment
CG9829 2003-01-01 Sim4 clustering to Release 3
CG9829 2003-07-26 Blastp of sequenced clone
poly 2008-04-29 Release 5.5 accounting
poly 2008-08-15 Release 5.9 accounting
poly 2008-12-18 5.12 accounting

Clone Sequence Records

LD12690.complete Sequence

1140 bp (1140 high quality bases) assembled on 2003-07-26

GenBank Submission: BT011120

> LD12690.complete
AACATGTTTTTCATGTCAAAATTGTATATTTGTTTCGTAAACTAAACCGA
GAAAGTGAATCCCTTGCCACCATTGAATTGATATCTAAGCCCGGCAGTCC
TCCAAACCAACGGATCGAAACAATGGCCACCTCAGTCCTGCTAGCCTGTG
GACTCAATGAGCAGAAATTGCCAGGATTTGTCCACATCAGCGAGGAGTCC
AATGTGGATGCCAGCTTTTTGATCAGCTGCGTTTTGGGTCAGAGATTGCG
CATCTCAAATGCTGGAACTCTGCTCGTCTGTTTGCAGCATCACTACCAGC
ATTATTTTAATGCTGGCATGAGGTTGGGCTATAATACGAACATTTTCCAG
GGGAAAACTCTGGGTGTTATCGATGTTCTGAGCGACATGGCCGGCGAGGG
ATTGGCTTCCAAATGGCTAACGAATACCGAGGGTCAGACATTAACCGACC
AGCTAGTAGAGGATATTCGCGCCCAGGTGGAGAGGAACTATGCCAGTCGC
AACTCATATACGGTTCTGATCGACAATCTGTCCATATTGTTCAATTTGGG
AGCAAGCAAGCTGCAGGTTCAGCAGTTCTGCCAGGACCTGGCTGCGCTAG
GCAAGGAGCGCGAAAAGCTGACGGTGATCACCAAGCTCAGCAACAGCGAC
ATCTACCAGCTGACGGACAACAATGTCGCCAAGCTCGGTCAGGTGCGCAT
CCAGGTGTTGCGTTTAAAGAGCGGTGTCTTCCGTGAGGTGGATGGCAAGC
TGCTAATCGAACGCGTTCTGGACGAAGGAAACTATGCCTGCGAGGAGACA
CGCAAGGAGGTGCTCTACAAGGTCAACGATCGCAACGTCAAGGTCTTTGC
ACCCGGCGAAATTGGGGTCAAAGTCTAAAGGCTGCATAAGCTCAAATAAT
TGTATGAATTTTAATAAAGCCATTTTTTGTATATTCCAAACATAGCCAGT
CAAAGGTTTCATATTGCGTCGGAATATACAGTGCTTGTTTCAAATTTTGA
AATGGTAAATCAAGCGATTAGACTTGTAATTGGAACCATATTTTAGTTAT
ATTTTTGCAAATATGTCATTCTGTTTCCTAGGCTAGATGTAGGAATTAAA
ATTAATTTAAATTTAAATTAAAAAAAAAAAAAAAAAAAAA

LD12690.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
poly-RA 1309 poly-RA 191..1309 1..1119 5595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9187036..9188042 1119..113 4975 99.6 Minus
chr3R 27901430 chr3R 9191943..9192055 113..1 550 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:59:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13361844..13362858 1127..113 5075 100 Minus
3R 32079331 3R 13366760..13366872 113..1 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13102675..13103689 1127..113 5075 100 Minus
3R 31820162 3R 13107591..13107703 113..1 565 100 Minus
Blast to na_te.dros performed 2019-03-16 21:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 1689..1767 1070..995 134 68.4 Minus

LD12690.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:43:38 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9187060..9188041 114..1095 99 <- Minus
chr3R 9191943..9192055 1..113 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:46:41 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 1..756 123..878 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:05 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RB 1..756 123..878 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:04:45 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 1..756 123..878 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:44:01 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 1..756 123..878 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:29:10 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 1..756 123..878 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:27 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 32..1150 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:05 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 36..1154 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:04:45 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 39..1157 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:44:02 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 32..1150 1..1119 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:29:10 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
poly-RA 39..1157 1..1119 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:43:38 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13361852..13362857 114..1119 100 <- Minus
3R 13366760..13366872 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:43:38 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13361852..13362857 114..1119 100 <- Minus
3R 13366760..13366872 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:43:38 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13361852..13362857 114..1119 100 <- Minus
3R 13366760..13366872 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:04:45 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9187574..9188579 114..1119 100 <- Minus
arm_3R 9192482..9192594 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:26:59 Download gff for LD12690.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13107591..13107703 1..113 100   Minus
3R 13102683..13103688 114..1119 100 <- Minus

LD12690.hyp Sequence

Translation from 2 to 877

> LD12690.hyp
HVFHVKIVYLFRKLNRESESLATIELISKPGSPPNQRIETMATSVLLACG
LNEQKLPGFVHISEESNVDASFLISCVLGQRLRISNAGTLLVCLQHHYQH
YFNAGMRLGYNTNIFQGKTLGVIDVLSDMAGEGLASKWLTNTEGQTLTDQ
LVEDIRAQVERNYASRNSYTVLIDNLSILFNLGASKLQVQQFCQDLAALG
KEREKLTVITKLSNSDIYQLTDNNVAKLGQVRIQVLRLKSGVFREVDGKL
LIERVLDEGNYACEETRKEVLYKVNDRNVKVFAPGEIGVKV*

LD12690.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
poly-PB 251 CG9829-PB 1..251 41..291 1268 100 Plus
poly-PA 251 CG9829-PA 1..251 41..291 1268 100 Plus

LD12690.pep Sequence

Translation from 122 to 877

> LD12690.pep
MATSVLLACGLNEQKLPGFVHISEESNVDASFLISCVLGQRLRISNAGTL
LVCLQHHYQHYFNAGMRLGYNTNIFQGKTLGVIDVLSDMAGEGLASKWLT
NTEGQTLTDQLVEDIRAQVERNYASRNSYTVLIDNLSILFNLGASKLQVQ
QFCQDLAALGKEREKLTVITKLSNSDIYQLTDNNVAKLGQVRIQVLRLKS
GVFREVDGKLLIERVLDEGNYACEETRKEVLYKVNDRNVKVFAPGEIGVK
V*

LD12690.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17390-PA 251 GF17390-PA 1..251 1..251 1227 92 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17062-PA 251 GG17062-PA 1..251 1..251 1276 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18551-PA 251 GH18551-PA 1..251 1..251 1145 86.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
poly-PB 251 CG9829-PB 1..251 1..251 1268 100 Plus
poly-PA 251 CG9829-PA 1..251 1..251 1268 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23250-PA 252 GI23250-PA 1..252 1..251 1100 83.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23070-PA 251 GL23070-PA 1..251 1..251 1204 90 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22063-PA 251 GA22063-PA 1..251 1..251 1208 90.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25947-PA 251 GM25947-PA 1..251 1..251 1287 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20507-PA 251 GD20507-PA 1..251 1..251 1274 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10747-PA 251 GJ10747-PA 1..251 1..251 1119 84.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13353-PA 251 GK13353-PA 1..251 1..251 1159 86.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24450-PA 251 GE24450-PA 1..251 1..251 1283 96.8 Plus