Clone LD12750 Report

Search the DGRC for LD12750

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:127
Well:50
Vector:pBS SK-
Associated Gene/TranscriptCG1840-RA
Protein status:LD12750.pep: gold
Preliminary Size:929
Sequenced Size:725

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1840 2001-01-01 Release 2 assignment
CG1840 2002-03-19 Blastp of sequenced clone
CG1840 2003-01-01 Sim4 clustering to Release 3
CG1840 2008-04-29 Release 5.5 accounting
CG1840 2008-08-15 Release 5.9 accounting
CG1840 2008-12-18 5.12 accounting

Clone Sequence Records

LD12750.complete Sequence

725 bp (725 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094783

> LD12750.complete
TCTAAACACCACGTCAATTTTTTTTTTTTATACACAAACAAATCAAAATA
TTCAGCTTCGGCCCAGATCTGGAAATATTTGAAAGAAACAAAAGATATTG
CATGCTAATTTAGCTTTAAAATGGCGTACGTCGATCAAAATGGTCGTCTG
TGGGAGAAACGTCCATGGGACTTGAGACGAGTTTTGGACACATTCGTGGG
TATATGGTTCGCCGTCAAACAGTTGCTTGCATCGTTCCTGTCTCCATTCA
CTGGAAATGATAGCAACGGAGATAACTCCCGTCGAGGAAATGGATGGGGA
AGTAGTAGCTGGGGCGGAGGGGGCGGTGGTGGTGGCGGCGGAGGCGGTGG
CGGCGGAGGCGGTGGCGGAGGCGGAGGCGGTAGCGGTTATCGCGGAGGTG
GATTAAGGCCTAATCGACGAATTGGGCGCATTCCGCCCCCCTCCCAATCC
TGCAATGCCGGAGGATGCTGCGGCTGAGCTGCTTAACCAAAATGCTCCAA
TAAATAATCCAACTCACCTCTGTGATGCGGCAATTAAAATAGATAGGTTT
TTGTTTACCGTTTATATTAAAGCTATGTTTTAGTCATAATGATTTTGATT
AATTGAGAAAATTCAAAATATGCAATCATACATACAATGCAATACAATAC
ATACATACAATCATACAAACAATAAACTTTTTAATATCCGAACTTAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

LD12750.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1840-RA 809 CG1840-RA 98..792 1..696 3440 99.8 Plus
CG1840.a 728 CG1840.a 35..726 1..696 3370 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11779848..11780318 225..695 2355 100 Plus
chrX 22417052 chrX 11779509..11779646 1..139 645 99.3 Plus
chrX 22417052 chrX 11779704..11779789 140..225 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:59:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11888716..11889187 225..696 2360 100 Plus
X 23542271 X 11888377..11888514 1..139 645 99.3 Plus
X 23542271 X 11888572..11888657 140..225 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11896814..11897285 225..696 2360 100 Plus
X 23527363 X 11896475..11896612 1..139 655 99.2 Plus
X 23527363 X 11896670..11896755 140..225 430 100 Plus
Blast to na_te.dros performed 2019-03-16 00:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1468..1586 558..676 108 56.7 Plus

LD12750.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:36 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11779509..11779646 1..139 99 -> Plus
chrX 11779704..11779788 140..224 100 -> Plus
chrX 11779848..11779935 225..312 100 == Plus
chrX 11780010..11780245 387..622 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:46:42 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 1..357 121..477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:29:17 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 1..357 121..477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:42 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 1..357 121..477 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:22 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 1..357 121..477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:01:46 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 1..357 121..477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:55:39 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 20..713 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:29:17 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 20..713 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:42 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 26..719 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:03:22 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 20..713 1..695 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:01:46 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
CG1840-RA 26..719 1..695 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:36 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
X 11888377..11888514 1..139 99 -> Plus
X 11888572..11888656 140..224 100 -> Plus
X 11888716..11889186 225..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:36 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
X 11888377..11888514 1..139 99 -> Plus
X 11888572..11888656 140..224 100 -> Plus
X 11888716..11889186 225..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:36 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
X 11888377..11888514 1..139 99 -> Plus
X 11888572..11888656 140..224 100 -> Plus
X 11888716..11889186 225..695 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:42 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11782410..11782547 1..139 99 -> Plus
arm_X 11782605..11782689 140..224 100 -> Plus
arm_X 11782749..11783219 225..695 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:36:55 Download gff for LD12750.complete
Subject Subject Range Query Range Percent Splice Strand
X 11896814..11897284 225..695 100   Plus
X 11896475..11896612 1..139 99 -> Plus
X 11896670..11896754 140..224 100 -> Plus

LD12750.pep Sequence

Translation from 120 to 476

> LD12750.pep
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG*

LD12750.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21576-PA 110 GF21576-PA 1..109 1..118 268 61 Plus
Dana\GF21575-PA 106 GF21575-PA 1..101 1..113 245 64.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18452-PA 115 GG18452-PA 1..115 1..118 360 83.9 Plus
Dere\GG18451-PA 112 GG18451-PA 1..107 1..113 226 61.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12277-PA 590 GH12277-PA 1..107 1..117 189 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG1840-PA 118 CG1840-PA 1..118 1..118 674 100 Plus
CG1840-PB 117 CG1840-PB 1..117 1..118 658 99.2 Plus
SelG-PA 110 CG1844-PA 1..110 1..118 389 63.6 Plus
caz-PD 355 CG3606-PD 145..207 43..94 159 54 Plus
caz-PC 384 CG3606-PC 174..236 43..94 159 54 Plus
caz-PB 399 CG3606-PB 189..251 43..94 159 54 Plus
TwdlT-PA 286 CG5812-PA 65..113 45..94 151 62 Plus
Hrb87F-PE 385 CG12749-PE 259..348 45..115 151 43.3 Plus
Hrb87F-PD 385 CG12749-PD 259..348 45..115 151 43.3 Plus
Hrb87F-PC 385 CG12749-PC 259..348 45..115 151 43.3 Plus
Hrb87F-PA 385 CG12749-PA 259..348 45..115 151 43.3 Plus
caz-PD 355 CG3606-PD 164..240 46..116 147 45.5 Plus
caz-PC 384 CG3606-PC 193..269 46..116 147 45.5 Plus
caz-PB 399 CG3606-PB 208..284 46..116 147 45.5 Plus
CG11458-PA 98 CG11458-PA 41..96 45..94 147 53.6 Plus
TwdlT-PA 286 CG5812-PA 64..144 43..109 147 46.9 Plus
CG14742-PA 74 CG14742-PA 2..67 50..115 146 47 Plus
Rbp1-like-PC 158 CG1987-PC 84..118 60..94 146 77.1 Plus
Rbp1-like-PA 158 CG1987-PA 84..118 60..94 146 77.1 Plus
Rbp1-like-PB 247 CG1987-PB 84..118 60..94 146 77.1 Plus
Nopp140-PA 720 CG7421-PA 640..683 51..94 146 63.6 Plus
Nopp140-PE 773 CG7421-PE 693..736 51..94 146 63.6 Plus
caz-PD 355 CG3606-PD 169..230 45..97 145 51.6 Plus
caz-PC 384 CG3606-PC 198..259 45..97 145 51.6 Plus
caz-PB 399 CG3606-PB 213..274 45..97 145 51.6 Plus
CG5172-PC 106 CG5172-PC 25..54 65..94 145 86.7 Plus
CG5172-PD 172 CG5172-PD 25..54 65..94 145 86.7 Plus
CG4038-PA 237 CG4038-PA 3..57 39..94 145 55.4 Plus
CG4038-PA 237 CG4038-PA 7..68 54..109 145 51.6 Plus
Nopp140-PA 720 CG7421-PA 636..690 43..93 145 58.2 Plus
Nopp140-PE 773 CG7421-PE 689..743 43..93 145 58.2 Plus
CG33181-PI 670 CG33181-PI 168..212 43..93 145 58.8 Plus
CG5778-PC 117 CG5778-PC 44..102 50..94 144 54.2 Plus
CG5778-PA 117 CG5778-PA 44..102 50..94 144 54.2 Plus
CG10853-PA 155 CG10853-PA 55..84 65..94 144 83.3 Plus
CG33181-PE 526 CG32714-PE 35..68 60..93 144 76.5 Plus
CG33181-PJ 550 CG33181-PJ 59..92 60..93 144 76.5 Plus
CG33181-PD 679 CG33181-PA 188..221 60..93 144 76.5 Plus
CG33181-PH 696 CG33181-PH 205..238 60..93 144 76.5 Plus
CG33181-PG 696 CG32714-PG 205..238 60..93 144 76.5 Plus
CG33181-PF 696 CG32714-PF 205..238 60..93 144 76.5 Plus
CG33181-PC 696 CG32714-PC 205..238 60..93 144 76.5 Plus
fs(1)h-PB 2038 CG2252-PB 1798..1888 44..118 144 40.7 Plus
fs(1)h-PG 2046 CG2252-PG 1806..1896 44..118 144 40.7 Plus
CG13376-PC 193 CG13376-PC 53..96 51..94 143 56.8 Plus
CG13376-PB 200 CG13376-PB 60..103 51..94 143 56.8 Plus
CG13376-PD 204 CG13376-PD 64..107 51..94 143 56.8 Plus
Fib-PA 344 CG9888-PA 55..111 45..101 143 47.4 Plus
CG5778-PC 117 CG5778-PC 48..111 45..95 142 48.4 Plus
CG5778-PA 117 CG5778-PA 48..111 45..95 142 48.4 Plus
CG13376-PC 193 CG13376-PC 63..101 56..94 142 61.5 Plus
CG13376-PB 200 CG13376-PB 70..108 56..94 142 61.5 Plus
CG13376-PD 204 CG13376-PD 74..112 56..94 142 61.5 Plus
Cpr47Ef-PD 601 CG13214-PD 223..305 33..115 142 41 Plus
Cpr47Ef-PC 612 CG13214-PC 223..305 33..115 142 41 Plus
CG11458-PA 98 CG11458-PA 9..73 35..94 141 46.2 Plus
CG11458-PA 98 CG11458-PA 36..83 52..94 140 60.4 Plus
CG30334-PB 128 CG30334-PB 27..117 41..118 140 42.9 Plus
CG30334-PA 130 CG30334-PA 29..119 41..118 140 42.9 Plus
CG4038-PA 237 CG4038-PA 2..38 58..94 139 70.3 Plus
CG2150-PA 188 CG2150-PA 22..66 49..93 139 60 Plus
CG5172-PC 106 CG5172-PC 24..73 56..94 137 56 Plus
CG5172-PD 172 CG5172-PD 24..73 56..94 137 56 Plus
CG5172-PD 172 CG5172-PD 118..171 45..94 137 53.7 Plus
CG14191-PA 193 CG14191-PA 18..94 43..118 137 46.2 Plus
Rbp1-like-PC 158 CG1987-PC 80..143 47..110 135 45.3 Plus
Rbp1-like-PA 158 CG1987-PA 80..143 47..110 135 45.3 Plus
CG14742-PA 74 CG14742-PA 6..54 45..93 134 51 Plus
CG11458-PA 98 CG11458-PA 51..98 45..90 133 54.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10973-PA 102 GI10973-PA 1..97 1..116 164 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20156-PA 70 GL20156-PA 1..59 1..59 166 47.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26643-PA 106 GA26643-PA 1..100 1..113 178 51.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19653-PA 116 GM19653-PA 1..116 1..118 352 90.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17056-PA 118 GD17056-PA 1..118 1..118 367 93.2 Plus
Dsim\GD17055-PA 80 GD17055-PA 1..70 1..76 196 63.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18532-PA 108 GJ18532-PA 1..107 1..115 179 48.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25420-PA 108 GK25420-PA 1..107 1..116 184 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15674-PA 117 GE15674-PA 1..117 1..118 356 87.3 Plus
Dyak\GE15673-PA 111 GE15673-PA 1..106 1..113 235 62.8 Plus

LD12750.hyp Sequence

Translation from 120 to 476

> LD12750.hyp
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG*

LD12750.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1840-PA 118 CG1840-PA 1..118 1..118 674 100 Plus
CG1840-PB 117 CG1840-PB 1..117 1..118 658 99.2 Plus
SelG-PA 110 CG1844-PA 1..110 1..118 389 63.6 Plus
caz-PD 355 CG3606-PD 145..207 43..94 159 54 Plus
caz-PC 384 CG3606-PC 174..236 43..94 159 54 Plus
caz-PD 355 CG3606-PD 164..240 46..116 147 45.5 Plus
caz-PD 355 CG3606-PD 169..230 45..97 145 51.6 Plus