Clone LD13628 Report

Search the DGRC for LD13628

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:136
Well:28
Vector:pBS SK-
Associated Gene/TranscriptCG32579-RA
Protein status:LD13628.pep: gold
Preliminary Size:1417
Sequenced Size:1273

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32579 2005-08-08 Manual selection by Mark Stapleton
CG32579 2008-04-29 Release 5.5 accounting
CG32579 2008-04-29 Picked prior to 5.5
CG32579 2008-08-15 Release 5.9 accounting
CG32579 2008-12-18 5.12 accounting

Clone Sequence Records

LD13628.complete Sequence

1273 bp assembled on 2007-09-25

GenBank Submission: BT030989

> LD13628.complete
CTAATCTTCAGTGTTTTGTTTTTTTTTTTTAGTCGAAAACCAGTGTCAGC
AAGTTGAAGGCGAGAGTAGTTTGGAGGTCGAGGCCTTGGATATTTGTGTG
TGGCTAGGGTGGCACATGTGCAATAAGGAGGCGGAGGAGACATGGCCTCC
GCGGAGCAAAGAACCGAAGTGGACGCCCTTATGATGGGGCCGATCTCGAA
ACTAAGCATGCTGCTCACTGTGGTGTCCATTCTGTGGCGCTTCGTCTCGA
TTTGCATCAACTGGAGCCTGGCGTACGTGTACTGGATGGAGGAGTCCTAC
GGATACTGCGCCTGGACCATTGGCTCCATTCTGGTGCCCATGGTGGTCAC
ATCGGTCATATATATACATACCTTGAAGAGCGCTCATGCCGGCGAAAAAC
GCATCCTGGAGCGAGGGGTGTACTCAAATGCTGTGATCTCATATCTCTTC
CGCGATGTCTATGTCCTAAACTATGCGTTCAAATACTCGTTGGCCAAGGA
GCGGGATGACAAGCAGGCGGAGATCGAATATTACCAAAAACTCATGACGG
AGGAGTGCAATGTTAGTTTCGTTCGTCTATTCGACTCGTTTTTGGAATCA
GCACCGCAGAAAATACTACAGCTGGCAATTCTTTTGCAATCGACATTGGA
GTTCACATACTACCGCCACATCGCCCTGATCGTCTACTTCGGCAACATAG
CGTGGTGCATCCAGGCGTACAATCACTCCAATCGCCTGGCCCAACTGGAC
AAACATGATATTGCGGCGAAGGGACGATTTCTGCAATTTCTCTTCCTGCT
CTGCCTCACTGTTTCGAGAACGCTTTGCATCGCGTATGTGGCCAGTATTT
TTCCCATCGAAACGCTGATCATCTGCGCGACACTGGCTTGCTTTTACGGC
ACCATTGTGTTCTTTGTGGACTCGCCAATGATCGCAAAATCCCGCCCCAT
GAACTATTCGTACTGCCTGTGCTTTGGCGTTGTCTATCTATTTATTTTTA
CGCCCGTCAAGGATGCACCAACCAAATATAAGTACGCCTTCTATCTCACA
TTCTGTTTGTTGCAAAATATCATCGCCTGCGCTTTGTACATTCCCTTGTA
TCTTGCCACAGCCATCATTGCCTTGTATATTGTCGGAATTGTTCTGTTAA
TAATCTACTACACGTACTGCCATCCAAATACTGTGCGTACTTATTTTTAA
AATTCTAGCATAATTAGTAGCATTTTGTATATTTGCAATAAACGTTGTTA
TGCCCAAAAAAAAAAAAAAAAAA

LD13628.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32579-RA 1373 CG32579-RA 63..1317 1..1256 6240 99.9 Plus
CG32579.a 1287 CG32579.a 18..1241 33..1256 6120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16214400..16214844 811..1255 2150 98.9 Plus
chrX 22417052 chrX 16213052..16213421 1..371 1805 99.7 Plus
chrX 22417052 chrX 16213498..16213653 372..527 780 100 Plus
chrX 22417052 chrX 16214166..16214325 652..811 770 98.8 Plus
chrX 22417052 chrX 16213803..16213933 528..658 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16324676..16325121 811..1256 2230 100 Plus
X 23542271 X 16323328..16323697 1..371 1805 99.7 Plus
X 23542271 X 16323774..16323929 372..527 780 100 Plus
X 23542271 X 16324442..16324601 652..811 770 98.8 Plus
X 23542271 X 16324079..16324209 528..658 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16332774..16333219 811..1256 2230 100 Plus
X 23527363 X 16331426..16331795 1..371 1815 99.7 Plus
X 23527363 X 16331872..16332027 372..527 780 100 Plus
X 23527363 X 16332540..16332699 652..811 770 98.7 Plus
X 23527363 X 16332177..16332307 528..658 655 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:14:10 has no hits.

LD13628.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:15:15 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16213052..16213421 1..371 99 -> Plus
chrX 16213498..16213653 372..527 100 -> Plus
chrX 16213803..16213933 528..658 100 -> Plus
chrX 16214173..16214325 659..811 100 -> Plus
chrX 16214401..16214844 812..1255 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:47:45 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 1..1059 142..1200 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:04:06 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 1..1059 142..1200 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:19 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 1..1059 142..1200 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:49:49 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 1..1059 142..1200 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:39 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 1..1059 142..1200 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:55:20 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 41..1294 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:04:06 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 41..1294 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:19 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 43..1296 1..1255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:49:50 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 41..1294 1..1255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:39 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
CG32579-RA 43..1296 1..1255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:15 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
X 16324449..16324601 659..811 100 -> Plus
X 16323328..16323697 1..371 99 -> Plus
X 16323774..16323929 372..527 100 -> Plus
X 16324079..16324209 528..658 100 -> Plus
X 16324677..16325120 812..1255 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:15 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
X 16324449..16324601 659..811 100 -> Plus
X 16323328..16323697 1..371 99 -> Plus
X 16323774..16323929 372..527 100 -> Plus
X 16324079..16324209 528..658 100 -> Plus
X 16324677..16325120 812..1255 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:15 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
X 16324449..16324601 659..811 100 -> Plus
X 16323328..16323697 1..371 99 -> Plus
X 16323774..16323929 372..527 100 -> Plus
X 16324079..16324209 528..658 100 -> Plus
X 16324677..16325120 812..1255 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:19 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16217361..16217730 1..371 99 -> Plus
arm_X 16217807..16217962 372..527 100 -> Plus
arm_X 16218112..16218242 528..658 100 -> Plus
arm_X 16218482..16218634 659..811 100 -> Plus
arm_X 16218710..16219153 812..1255 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:56:11 Download gff for LD13628.complete
Subject Subject Range Query Range Percent Splice Strand
X 16331426..16331795 1..371 99 -> Plus
X 16331872..16332027 372..527 100 -> Plus
X 16332177..16332307 528..658 100 -> Plus
X 16332547..16332699 659..811 100 -> Plus
X 16332775..16333218 812..1255 100   Plus

LD13628.pep Sequence

Translation from 141 to 1199

> LD13628.pep
MASAEQRTEVDALMMGPISKLSMLLTVVSILWRFVSICINWSLAYVYWME
ESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVIS
YLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSF
LESAPQKILQLAILLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLA
QLDKHDIAAKGRFLQFLFLLCLTVSRTLCIAYVASIFPIETLIICATLAC
FYGTIVFFVDSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAF
YLTFCLLQNIIACALYIPLYLATAIIALYIVGIVLLIIYYTYCHPNTVRT
YF*

LD13628.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17953-PA 352 GG17953-PA 1..352 1..352 1603 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12280-PA 353 GH12280-PA 1..353 1..352 909 49.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32579-PA 352 CG32579-PA 1..352 1..352 1835 100 Plus
CG32579-PB 359 CG32579-PB 1..359 1..352 1817 98.1 Plus
CG32579-PC 237 CG32579-PC 1..223 1..223 1151 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10978-PA 355 GI10978-PA 21..355 18..352 958 53.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21345-PA 136 GL21345-PA 3..132 1..135 367 52.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23155-PA 347 GA23155-PA 3..343 1..346 1190 65 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13425-PA 284 GM13425-PA 12..284 80..352 1266 91.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17275-PA 352 GD17275-PA 1..352 1..352 1671 93.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19443-PA 347 GJ19443-PA 11..347 16..352 954 52.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25056-PA 355 GK25056-PA 73..353 70..350 882 59.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17261-PA 352 GE17261-PA 1..352 1..352 1629 90.6 Plus

LD13628.hyp Sequence

Translation from 141 to 1199

> LD13628.hyp
MASAEQRTEVDALMMGPISKLSMLLTVVSILWRFVSICINWSLAYVYWME
ESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVIS
YLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSF
LESAPQKILQLAILLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLA
QLDKHDIAAKGRFLQFLFLLCLTVSRTLCIAYVASIFPIETLIICATLAC
FYGTIVFFVDSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAF
YLTFCLLQNIIACALYIPLYLATAIIALYIVGIVLLIIYYTYCHPNTVRT
YF*

LD13628.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32579-PA 352 CG32579-PA 1..352 1..352 1835 100 Plus
CG32579-PB 359 CG32579-PB 1..359 1..352 1817 98.1 Plus
CG32579-PC 237 CG32579-PC 1..223 1..223 1151 100 Plus