Clone LD13662 Report

Search the DGRC for LD13662

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:136
Well:62
Vector:pBS SK-
Associated Gene/TranscriptRpS9-RA
Protein status:LD13662.pep: gold
Sequenced Size:732

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpS9-RD 2009-06-18 Manual selection by Ken Wan

Clone Sequence Records

LD13662.complete Sequence

732 bp assembled on 2009-07-27

GenBank Submission: BT088955.1

> LD13662.complete
AAAACCTGCTCGGTTGAATTGTCGGAACCATGGTGAACGGCCGCATACCC
TCGGTCTTCTCGAAGACCTACGTGACTCCCCGTCGCCCCTATGAGAAGGC
GCGTCTGGACCAGGAGTTGAAGATCATCGGCGAGTATGGTCTGCGCAACA
AGCGCGAAGTGTGGCGCGTCAAGTACGCCCTGGCTAAGATCCGTAAGGCC
GCTCGTGAGCTGCTGACCCTCGACGAGAAGGACGAGAAGCGTCTGTTCCA
GGGTAATGCCCTGCTGCGCCGTCTGGTCCGTATCGGTGTCCTGGACGAGT
CCCGCATGAAGCTCGATTACGTGCTGGGTCTGAAGATTGAGGACTTCTTG
GAGCGTCGTCTGCAGACGCAGGTGTTCAAGCTGGGACTTGCCAAGTCCAT
CCATCATGCTCGCGTCCTGATCCGTCAGCGTCACATTCGTGTCCGCAAGC
AGGTGGTCAACATCCCGTCGTTCGTCGTGCGCCTGGACTCCCAGAAGCAC
ATCGACTTCTCCCTGAAGTCGCCCTTCGGCGGCGGCCGTCCCGGTCGCGT
CAAGAGGAAGAACCTGAAGAAGAACCAGGGCGGTGGCGGTGGAGCTGCTG
AAGAGGAGGAGGACTAAGCAGTGGTAGCCAGCTGTAGCCAAGACAAATAC
ATGGCGCAGACTTGATAAAAATCCGTTTGCTTTACACAAATAAATGTAAA
AATACACGAAAAAAAAAAAAAAAAAAAAAAAA

LD13662.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpS9-RA 922 RpS9-RA 106..815 1..710 3550 100 Plus
RpS9-RD 967 RpS9-RD 169..872 7..710 3520 100 Plus
RpS9-RB 928 RpS9-RB 38..476 1..439 2195 100 Plus
RpS9-RB 928 RpS9-RB 660..928 440..708 1345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9501755..9502024 708..439 1350 100 Minus
chr3L 24539361 chr3L 9502917..9503166 256..7 1250 100 Minus
chr3L 24539361 chr3L 9502330..9502517 439..252 940 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9509888..9510159 710..439 1360 100 Minus
3L 28110227 3L 9511052..9511301 256..7 1250 100 Minus
3L 28110227 3L 9510465..9510652 439..252 940 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9502988..9503259 710..439 1360 100 Minus
3L 28103327 3L 9504152..9504401 256..7 1250 100 Minus
3L 28103327 3L 9503565..9503752 439..252 940 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:57:30 has no hits.

LD13662.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:58:29 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9501755..9502023 440..708 100 <- Minus
chr3L 9502330..9502516 253..439 100 <- Minus
chr3L 9502921..9503166 7..252 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:51 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RD 1..588 30..617 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:16 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RD 1..588 30..617 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:41:12 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RA 1..588 30..617 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:37 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RA 1..588 30..617 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-27 14:02:25 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RA 38..745 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:15 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RA 38..745 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:41:12 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RA 27..734 1..708 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:37 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RA 27..734 1..708 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:29 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9509890..9510158 440..708 100 <- Minus
3L 9510465..9510651 253..439 100 <- Minus
3L 9511056..9511301 7..252 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:29 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9509890..9510158 440..708 100 <- Minus
3L 9510465..9510651 253..439 100 <- Minus
3L 9511056..9511301 7..252 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:29 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9509890..9510158 440..708 100 <- Minus
3L 9510465..9510651 253..439 100 <- Minus
3L 9511056..9511301 7..252 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:41:12 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9502990..9503258 440..708 100 <- Minus
arm_3L 9503565..9503751 253..439 100 <- Minus
arm_3L 9504156..9504401 7..252 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:59 Download gff for LD13662.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9502990..9503258 440..708 100 <- Minus
3L 9503565..9503751 253..439 100 <- Minus
3L 9504156..9504401 7..252 100   Minus

LD13662.pep Sequence

Translation from 29 to 616

> LD13662.pep
MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYA
LAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLG
LKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVV
RLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED*

LD13662.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24655-PA 195 GF24655-PA 1..195 1..195 994 99.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14025-PA 195 GG14025-PA 1..195 1..195 998 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15146-PA 195 GH15146-PA 1..195 1..195 980 97.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
RpS9-PE 195 CG3395-PE 1..195 1..195 985 100 Plus
RpS9-PD 195 CG3395-PD 1..195 1..195 985 100 Plus
RpS9-PA 195 CG3395-PA 1..195 1..195 985 100 Plus
RpS9-PB 137 CG3395-PB 1..137 1..137 685 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12083-PA 195 GI12083-PA 1..195 1..195 986 98.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20135-PA 195 GL20135-PA 1..195 1..195 972 97.4 Plus
Dper\GL21280-PA 195 GL21280-PA 1..195 1..195 972 97.4 Plus
Dper\GL17960-PA 195 GL17960-PA 1..195 1..195 972 97.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28351-PA 195 GA28351-PA 1..195 1..195 972 97.4 Plus
Dpse\GA29203-PA 84 GA29203-PA 2..76 14..114 277 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24860-PA 195 GM24860-PA 1..195 1..195 998 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12912-PA 195 GD12912-PA 1..195 1..195 998 100 Plus
Dsim\GD17704-PA 138 GD17704-PA 91..138 148..195 168 91.7 Plus
Dsim\GD17704-PA 138 GD17704-PA 54..105 43..99 158 64.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13353-PA 195 GJ13353-PA 1..195 1..195 994 99.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17575-PA 195 GK17575-PA 1..195 1..195 994 99.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS9-PA 195 GE21228-PA 1..195 1..195 998 100 Plus

LD13662.hyp Sequence

Translation from 29 to 616

> LD13662.hyp
MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYA
LAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLG
LKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVV
RLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED*

LD13662.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
RpS9-PE 195 CG3395-PE 1..195 1..195 985 100 Plus
RpS9-PD 195 CG3395-PD 1..195 1..195 985 100 Plus
RpS9-PA 195 CG3395-PA 1..195 1..195 985 100 Plus
RpS9-PB 137 CG3395-PB 1..137 1..137 685 100 Plus