Clone LD13706 Report

Search the DGRC for LD13706

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:137
Well:6
Vector:pBS SK-
Associated Gene/TranscriptCG9628-RA
Protein status:LD13706.pep: gold
Preliminary Size:1299
Sequenced Size:1129

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9628 2001-01-01 Release 2 assignment
CG9628 2001-10-10 Blastp of sequenced clone
CG9628 2003-01-01 Sim4 clustering to Release 3
CG9628 2008-04-29 Release 5.5 accounting
CG9628 2008-08-15 Release 5.9 accounting
CG9628 2008-12-18 5.12 accounting

Clone Sequence Records

LD13706.complete Sequence

1129 bp (1129 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061168

> LD13706.complete
CGTGTCGTCGGTTTCAGAGGTTTTTTGAAAGACGGTTTTTAAAAAACCAA
TTTCCGCTCTGAGTCGCAGTTTAAACTGAACTACTGAAACTATTTAACGC
GCGTGAAAGAATTCATTGATTTATCTGTGTATTTAGTGTGAGATATAACT
TAACAGCTAACCCAAATCATTTGGCTGCACTTGTGTACCGCACCTATCTG
CAACTCAACGAAAATTTGAAAAATAAATCTCACGCGTCGAAATGTCGCCG
GCTGACGATAATTCCTTTGCCACAACTCATGGAAACAAAAAGGCCACCTA
CACGGTGATATGCATCAAGATTGTGGAACTGTGCCTGCTTATATGCTGTT
TGGGTCTGATCGACGAGCCGGCCACCAATTCTCATCTGCGGGTGTTCATC
ACTCCCCGAGTGGCTTCCCTTTGCTATGTGACCTTTGGAGCACTGACCAT
CTACACGGCAATCTATCTGATAATGGCGCTCTTCGGTGATTTGACTCCAT
GGCGTACGGCTACTTTGTGGAATCTAGTGGCCTTTGTGCTCTTCGTGGCC
GTAACCGCCCTGCTTTTCCGGGATTGGTCCACCACCAAGGATCGCAACTA
CTGGCACCCGAATATGCATCGTTTGGATCTCGTGATGGCTTCCGCCTCGA
TTGCCTTGGTTACCTCGCTGGTCTTCTTGCTGGACATACTCATCACCCTG
CGTTTAGGTGTCCACGGTGATCTAGAATGACATGGTCGATCCCGTGAAGT
TTGGCGAGAAAGAGATATACATTCGATTCTCGCCTAGCGTGGACTGTAAT
ATTTATAGCTCCAGCTTAGAAGTAAGAGCCCCGTTCACATACCCGTCTCC
CAGCTAATTGTAATCCCACAAGAAAACAAATTGCCATCATCGAATCGAAA
ATGTACAAAATCGACGTCCGAGGAGGTTTAAAGTTCTTAATCGGCTGCCC
TGTTTTGTTTTTTTTATAAGCTTAATACATCGAGCATCACGAATGTTATA
TCTAATTCAATTAATAAATAAGATTCAACGCAAATAAATTTTGTACGAGC
GAATAATATCCCAAATTAATAGTTTTTCTATTAAAACTGTCCAAATAAAA
ACGTCTTATTTAAAAAAAAAAAAAAAAAA

LD13706.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9628-RA 1277 CG9628-RA 135..1248 1..1114 5570 100 Plus
CG9628-RB 1068 CG9628-RB 182..1068 225..1111 4435 100 Plus
CG9628.a 1033 CG9628.a 179..1033 225..1079 4275 100 Plus
CG9628.a 1033 CG9628.a 1..126 3..128 630 100 Plus
CG9628-RB 1068 CG9628-RB 30..128 1..99 495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14617627..14618245 493..1111 3065 99.7 Plus
chr3L 24539361 chr3L 14612885..14613108 1..224 1105 99.6 Plus
chr3L 24539361 chr3L 14617405..14617567 331..493 815 100 Plus
chr3L 24539361 chr3L 14617091..14617197 225..331 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14627556..14628177 493..1114 3110 100 Plus
3L 28110227 3L 14622810..14623033 1..224 1120 100 Plus
3L 28110227 3L 14627334..14627496 331..493 815 100 Plus
3L 28110227 3L 14627020..14627126 225..331 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14620656..14621277 493..1114 3110 100 Plus
3L 28103327 3L 14615910..14616133 1..224 1120 100 Plus
3L 28103327 3L 14620434..14620596 331..493 815 100 Plus
3L 28103327 3L 14620120..14620226 225..331 535 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:57:05 has no hits.

LD13706.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:08 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14612885..14613108 1..224 99 -> Plus
chr3L 14617091..14617197 225..331 100 -> Plus
chr3L 14617406..14617566 332..492 100 -> Plus
chr3L 14617627..14618245 493..1111 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:47:51 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 23..528 225..730 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:37 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RC 23..528 225..730 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:09 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 23..528 225..730 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:25 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 23..528 225..730 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:52:17 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 23..528 225..730 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:57 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:36 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:09 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RA 15..1125 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:25 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:52:17 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RA 15..1125 1..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:08 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14622810..14623033 1..224 100 -> Plus
3L 14627020..14627126 225..331 100 -> Plus
3L 14627335..14627495 332..492 100 -> Plus
3L 14627556..14628174 493..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:08 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14622810..14623033 1..224 100 -> Plus
3L 14627020..14627126 225..331 100 -> Plus
3L 14627335..14627495 332..492 100 -> Plus
3L 14627556..14628174 493..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:08 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14622810..14623033 1..224 100 -> Plus
3L 14627020..14627126 225..331 100 -> Plus
3L 14627335..14627495 332..492 100 -> Plus
3L 14627556..14628174 493..1111 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:09 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14615910..14616133 1..224 100 -> Plus
arm_3L 14620120..14620226 225..331 100 -> Plus
arm_3L 14620435..14620595 332..492 100 -> Plus
arm_3L 14620656..14621274 493..1111 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:19 Download gff for LD13706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14615910..14616133 1..224 100 -> Plus
3L 14620120..14620226 225..331 100 -> Plus
3L 14620435..14620595 332..492 100 -> Plus
3L 14620656..14621274 493..1111 100   Plus

LD13706.hyp Sequence

Translation from 241 to 729

> LD13706.hyp
MSPADDNSFATTHGNKKATYTVICIKIVELCLLICCLGLIDEPATNSHLR
VFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPWRTATLWNLVAFVL
FVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASIALVTSLVFLLDIL
ITLRLGVHGDLE*

LD13706.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9628-PA 162 CG9628-PA 1..162 1..162 844 100 Plus
CG9628-PC 175 CG9628-PC 14..175 1..162 844 100 Plus
CG9628-PB 175 CG9628-PB 14..175 1..162 844 100 Plus

LD13706.pep Sequence

Translation from 241 to 729

> LD13706.pep
MSPADDNSFATTHGNKKATYTVICIKIVELCLLICCLGLIDEPATNSHLR
VFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPWRTATLWNLVAFVL
FVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASIALVTSLVFLLDIL
ITLRLGVHGDLE*

LD13706.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24609-PA 175 GF24609-PA 14..175 1..162 724 92 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15688-PA 175 GG15688-PA 14..175 1..162 826 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14752-PA 175 GH14752-PA 14..175 1..162 700 87 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9628-PA 162 CG9628-PA 1..162 1..162 844 100 Plus
CG9628-PC 175 CG9628-PC 14..175 1..162 844 100 Plus
CG9628-PB 175 CG9628-PB 14..175 1..162 844 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11493-PA 175 GI11493-PA 14..175 1..162 700 86.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21019-PA 175 GL21019-PA 14..175 1..162 722 92 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21923-PA 175 GA21923-PA 14..175 1..162 719 91.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25471-PA 175 GM25471-PA 14..175 1..162 833 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14494-PA 175 GD14494-PA 14..175 1..162 836 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13688-PA 175 GJ13688-PA 14..175 1..162 717 89.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10529-PA 175 GK10529-PA 14..175 1..162 683 84 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22019-PA 175 GE22019-PA 14..175 1..162 840 99.4 Plus