BDGP Sequence Production Resources |
Search the DGRC for LD13706
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 137 |
Well: | 6 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG9628-RA |
Protein status: | LD13706.pep: gold |
Preliminary Size: | 1299 |
Sequenced Size: | 1129 |
Gene | Date | Evidence |
---|---|---|
CG9628 | 2001-01-01 | Release 2 assignment |
CG9628 | 2001-10-10 | Blastp of sequenced clone |
CG9628 | 2003-01-01 | Sim4 clustering to Release 3 |
CG9628 | 2008-04-29 | Release 5.5 accounting |
CG9628 | 2008-08-15 | Release 5.9 accounting |
CG9628 | 2008-12-18 | 5.12 accounting |
1129 bp (1129 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061168
> LD13706.complete CGTGTCGTCGGTTTCAGAGGTTTTTTGAAAGACGGTTTTTAAAAAACCAA TTTCCGCTCTGAGTCGCAGTTTAAACTGAACTACTGAAACTATTTAACGC GCGTGAAAGAATTCATTGATTTATCTGTGTATTTAGTGTGAGATATAACT TAACAGCTAACCCAAATCATTTGGCTGCACTTGTGTACCGCACCTATCTG CAACTCAACGAAAATTTGAAAAATAAATCTCACGCGTCGAAATGTCGCCG GCTGACGATAATTCCTTTGCCACAACTCATGGAAACAAAAAGGCCACCTA CACGGTGATATGCATCAAGATTGTGGAACTGTGCCTGCTTATATGCTGTT TGGGTCTGATCGACGAGCCGGCCACCAATTCTCATCTGCGGGTGTTCATC ACTCCCCGAGTGGCTTCCCTTTGCTATGTGACCTTTGGAGCACTGACCAT CTACACGGCAATCTATCTGATAATGGCGCTCTTCGGTGATTTGACTCCAT GGCGTACGGCTACTTTGTGGAATCTAGTGGCCTTTGTGCTCTTCGTGGCC GTAACCGCCCTGCTTTTCCGGGATTGGTCCACCACCAAGGATCGCAACTA CTGGCACCCGAATATGCATCGTTTGGATCTCGTGATGGCTTCCGCCTCGA TTGCCTTGGTTACCTCGCTGGTCTTCTTGCTGGACATACTCATCACCCTG CGTTTAGGTGTCCACGGTGATCTAGAATGACATGGTCGATCCCGTGAAGT TTGGCGAGAAAGAGATATACATTCGATTCTCGCCTAGCGTGGACTGTAAT ATTTATAGCTCCAGCTTAGAAGTAAGAGCCCCGTTCACATACCCGTCTCC CAGCTAATTGTAATCCCACAAGAAAACAAATTGCCATCATCGAATCGAAA ATGTACAAAATCGACGTCCGAGGAGGTTTAAAGTTCTTAATCGGCTGCCC TGTTTTGTTTTTTTTATAAGCTTAATACATCGAGCATCACGAATGTTATA TCTAATTCAATTAATAAATAAGATTCAACGCAAATAAATTTTGTACGAGC GAATAATATCCCAAATTAATAGTTTTTCTATTAAAACTGTCCAAATAAAA ACGTCTTATTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9628-RA | 1277 | CG9628-RA | 135..1248 | 1..1114 | 5570 | 100 | Plus |
CG9628-RB | 1068 | CG9628-RB | 182..1068 | 225..1111 | 4435 | 100 | Plus |
CG9628.a | 1033 | CG9628.a | 179..1033 | 225..1079 | 4275 | 100 | Plus |
CG9628.a | 1033 | CG9628.a | 1..126 | 3..128 | 630 | 100 | Plus |
CG9628-RB | 1068 | CG9628-RB | 30..128 | 1..99 | 495 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 14617627..14618245 | 493..1111 | 3065 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 14612885..14613108 | 1..224 | 1105 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 14617405..14617567 | 331..493 | 815 | 100 | Plus |
chr3L | 24539361 | chr3L | 14617091..14617197 | 225..331 | 535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 14627556..14628177 | 493..1114 | 3110 | 100 | Plus |
3L | 28110227 | 3L | 14622810..14623033 | 1..224 | 1120 | 100 | Plus |
3L | 28110227 | 3L | 14627334..14627496 | 331..493 | 815 | 100 | Plus |
3L | 28110227 | 3L | 14627020..14627126 | 225..331 | 535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 14620656..14621277 | 493..1114 | 3110 | 100 | Plus |
3L | 28103327 | 3L | 14615910..14616133 | 1..224 | 1120 | 100 | Plus |
3L | 28103327 | 3L | 14620434..14620596 | 331..493 | 815 | 100 | Plus |
3L | 28103327 | 3L | 14620120..14620226 | 225..331 | 535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 14612885..14613108 | 1..224 | 99 | -> | Plus |
chr3L | 14617091..14617197 | 225..331 | 100 | -> | Plus |
chr3L | 14617406..14617566 | 332..492 | 100 | -> | Plus |
chr3L | 14617627..14618245 | 493..1111 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 23..528 | 225..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RC | 23..528 | 225..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 23..528 | 225..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 23..528 | 225..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 23..528 | 225..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RA | 1..1111 | 1..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RA | 1..1111 | 1..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RA | 15..1125 | 1..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RA | 1..1111 | 1..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RA | 15..1125 | 1..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14622810..14623033 | 1..224 | 100 | -> | Plus |
3L | 14627020..14627126 | 225..331 | 100 | -> | Plus |
3L | 14627335..14627495 | 332..492 | 100 | -> | Plus |
3L | 14627556..14628174 | 493..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14622810..14623033 | 1..224 | 100 | -> | Plus |
3L | 14627020..14627126 | 225..331 | 100 | -> | Plus |
3L | 14627335..14627495 | 332..492 | 100 | -> | Plus |
3L | 14627556..14628174 | 493..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14622810..14623033 | 1..224 | 100 | -> | Plus |
3L | 14627020..14627126 | 225..331 | 100 | -> | Plus |
3L | 14627335..14627495 | 332..492 | 100 | -> | Plus |
3L | 14627556..14628174 | 493..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 14615910..14616133 | 1..224 | 100 | -> | Plus |
arm_3L | 14620120..14620226 | 225..331 | 100 | -> | Plus |
arm_3L | 14620435..14620595 | 332..492 | 100 | -> | Plus |
arm_3L | 14620656..14621274 | 493..1111 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14615910..14616133 | 1..224 | 100 | -> | Plus |
3L | 14620120..14620226 | 225..331 | 100 | -> | Plus |
3L | 14620435..14620595 | 332..492 | 100 | -> | Plus |
3L | 14620656..14621274 | 493..1111 | 100 | Plus |
Translation from 241 to 729
> LD13706.hyp MSPADDNSFATTHGNKKATYTVICIKIVELCLLICCLGLIDEPATNSHLR VFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPWRTATLWNLVAFVL FVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASIALVTSLVFLLDIL ITLRLGVHGDLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9628-PA | 162 | CG9628-PA | 1..162 | 1..162 | 844 | 100 | Plus |
CG9628-PC | 175 | CG9628-PC | 14..175 | 1..162 | 844 | 100 | Plus |
CG9628-PB | 175 | CG9628-PB | 14..175 | 1..162 | 844 | 100 | Plus |
Translation from 241 to 729
> LD13706.pep MSPADDNSFATTHGNKKATYTVICIKIVELCLLICCLGLIDEPATNSHLR VFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPWRTATLWNLVAFVL FVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASIALVTSLVFLLDIL ITLRLGVHGDLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24609-PA | 175 | GF24609-PA | 14..175 | 1..162 | 724 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15688-PA | 175 | GG15688-PA | 14..175 | 1..162 | 826 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14752-PA | 175 | GH14752-PA | 14..175 | 1..162 | 700 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9628-PA | 162 | CG9628-PA | 1..162 | 1..162 | 844 | 100 | Plus |
CG9628-PC | 175 | CG9628-PC | 14..175 | 1..162 | 844 | 100 | Plus |
CG9628-PB | 175 | CG9628-PB | 14..175 | 1..162 | 844 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11493-PA | 175 | GI11493-PA | 14..175 | 1..162 | 700 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21019-PA | 175 | GL21019-PA | 14..175 | 1..162 | 722 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21923-PA | 175 | GA21923-PA | 14..175 | 1..162 | 719 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25471-PA | 175 | GM25471-PA | 14..175 | 1..162 | 833 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14494-PA | 175 | GD14494-PA | 14..175 | 1..162 | 836 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13688-PA | 175 | GJ13688-PA | 14..175 | 1..162 | 717 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10529-PA | 175 | GK10529-PA | 14..175 | 1..162 | 683 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22019-PA | 175 | GE22019-PA | 14..175 | 1..162 | 840 | 99.4 | Plus |