Clone LD13807 Report

Search the DGRC for LD13807

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:138
Well:7
Vector:pBS SK-
Associated Gene/TranscriptCG3226-RA
Protein status:LD13807.pep: gold
Preliminary Size:1025
Sequenced Size:851

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3226 2001-01-01 Release 2 assignment
CG3226 2001-10-10 Blastp of sequenced clone
CG3226 2003-01-01 Sim4 clustering to Release 3
CG3226 2008-04-29 Release 5.5 accounting
CG3226 2008-08-15 Release 5.9 accounting
CG3226 2008-12-18 5.12 accounting

Clone Sequence Records

LD13807.complete Sequence

851 bp (851 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061170

> LD13807.complete
ATCAACTGTTATTCAGACAAAACAAAATGTCATTGGAACAGCTGAAAAGC
GATGTGGCCGAGCTGGCGGCCTTCCTGCAGCAGGCGAAAGGTGCCCGCGT
AAAAGACGTGCTGACCACCGCTAAAGCGGAGGCGGAACGGGAGATTGTCA
ATCTGGAGTTGAAGGCCAAAATTGCGGCAGAGCGACAGGCCACCGGGTCG
AGCGAAGCCAAGAGATATCTGCACGAGCTGACCGACTACGGCTGGGACCA
GAGCGCCAAGTTCGTGAAGCTCTTCATCACCTTGAACGGAGTGCAGGGCT
GCACGGAGGAGAATGTGACAGTCACCTACACACCTAACTCGTTGCAGCTC
CATGTGCGCGATCTTCAGGGCAAGGACTTTGGGCTGACCGTAAACAATCT
GCTGCACAGTATCGATGTGGAGAAGAGCTACCGAAAGATCAAGACCGACA
TGGTGGCCATCTATCTGCAGAAGGTTGAGGACAAGCACTGGGATGTGCTC
ACCGCTATCCAGAAGCGTTTGAAGCAAAAGAAGGACAGCGAATTGTCCAA
AGATGGCGACAATCCCGAATCGGCGCTTGTTAACATCATGAAGAAGATGT
ACAACGACGGTGACTCCAAGACGAAGCAGATGATCGCCAAAGCTTGGACC
GAGAGTCAGGATAAGGCGAAGCTTGGCAAGGAGACGGGCGGCGGATTGGA
TTCTTTCGACGATCTTTAGATATGATAATAACCACACCCATTCGCGAATT
AGCTAACTACCTAAGGCACTGCTTCGATTCCAGCACAATTTGTATATGTG
GATAAATAAACTCCCAGCTAGGGCATTAAGTTAAAAAAAAAAAAAAAAAA
A

LD13807.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3226-RA 1205 CG3226-RA 357..1192 1..836 4180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6545367..6545984 832..213 2975 99 Minus
chrX 22417052 chrX 6546160..6546336 214..38 870 99.4 Minus
chrX 22417052 chrX 6546398..6546438 41..1 205 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6653109..6653732 836..213 3120 100 Minus
X 23542271 X 6653908..6654084 214..38 885 100 Minus
X 23542271 X 6654146..6654186 41..1 205 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6661207..6661830 836..213 3120 100 Minus
X 23527363 X 6662006..6662182 214..38 885 100 Minus
X 23527363 X 6662244..6662284 41..1 205 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:19:51 has no hits.

LD13807.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:20:53 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6545367..6545982 215..832 99 <- Minus
chrX 6546160..6546332 42..214 99 <- Minus
chrX 6546398..6546438 1..41 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:01 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..693 27..719 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:38 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..693 27..719 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:14:49 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..693 27..719 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:26 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..693 27..719 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:17:49 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..693 27..719 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:59 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..832 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:38 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..832 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:14:49 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 63..894 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:26 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 1..832 1..832 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:17:49 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
CG3226-RA 63..894 1..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:20:53 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
X 6653113..6653730 215..832 100 <- Minus
X 6653908..6654080 42..214 100 <- Minus
X 6654146..6654186 1..41 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:20:53 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
X 6653113..6653730 215..832 100 <- Minus
X 6653908..6654080 42..214 100 <- Minus
X 6654146..6654186 1..41 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:20:53 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
X 6653113..6653730 215..832 100 <- Minus
X 6653908..6654080 42..214 100 <- Minus
X 6654146..6654186 1..41 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:14:49 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6547146..6547763 215..832 100 <- Minus
arm_X 6547941..6548113 42..214 100 <- Minus
arm_X 6548179..6548219 1..41 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:20 Download gff for LD13807.complete
Subject Subject Range Query Range Percent Splice Strand
X 6661211..6661828 215..832 100 <- Minus
X 6662006..6662178 42..214 100 <- Minus
X 6662244..6662284 1..41 100   Minus

LD13807.hyp Sequence

Translation from 2 to 718

> LD13807.hyp
QLLFRQNKMSLEQLKSDVAELAAFLQQAKGARVKDVLTTAKAEAEREIVN
LELKAKIAAERQATGSSEAKRYLHELTDYGWDQSAKFVKLFITLNGVQGC
TEENVTVTYTPNSLQLHVRDLQGKDFGLTVNNLLHSIDVEKSYRKIKTDM
VAIYLQKVEDKHWDVLTAIQKRLKQKKDSELSKDGDNPESALVNIMKKMY
NDGDSKTKQMIAKAWTESQDKAKLGKETGGGLDSFDDL*

LD13807.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3226-PA 230 CG3226-PA 1..230 9..238 1163 100 Plus

LD13807.pep Sequence

Translation from 26 to 718

> LD13807.pep
MSLEQLKSDVAELAAFLQQAKGARVKDVLTTAKAEAEREIVNLELKAKIA
AERQATGSSEAKRYLHELTDYGWDQSAKFVKLFITLNGVQGCTEENVTVT
YTPNSLQLHVRDLQGKDFGLTVNNLLHSIDVEKSYRKIKTDMVAIYLQKV
EDKHWDVLTAIQKRLKQKKDSELSKDGDNPESALVNIMKKMYNDGDSKTK
QMIAKAWTESQDKAKLGKETGGGLDSFDDL*

LD13807.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21900-PA 230 GF21900-PA 1..230 1..230 864 78.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17668-PA 231 GG17668-PA 1..231 1..230 1115 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24241-PA 229 GH24241-PA 1..222 1..222 862 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3226-PA 230 CG3226-PA 1..230 1..230 1163 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21437-PA 225 GI21437-PA 1..221 1..222 881 76.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13373-PA 231 GL13373-PA 1..231 1..230 1003 81 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16794-PA 231 GA16794-PA 1..231 1..230 998 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12568-PA 231 GM12568-PA 1..231 1..230 1130 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16188-PA 231 GD16188-PA 1..231 1..230 1127 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16455-PA 228 GJ16455-PA 1..228 1..230 897 75.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25346-PA 232 GK25346-PA 1..221 1..219 929 81 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16458-PA 231 GE16458-PA 1..231 1..230 1114 92.2 Plus