Clone LD14049 Report

Search the DGRC for LD14049

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:140
Well:49
Vector:pBS SK-
Associated Gene/TranscriptSmB-RB
Protein status:LD14049.pep: gold
Preliminary Size:1141
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5352 2001-01-01 Release 2 assignment
CG5352 2001-10-10 Blastp of sequenced clone
CG5352 2003-01-01 Sim4 clustering to Release 3
SmB 2008-04-29 Release 5.5 accounting
SmB 2008-08-15 Release 5.9 accounting
SmB 2008-12-18 5.12 accounting

Clone Sequence Records

LD14049.complete Sequence

959 bp (959 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061171

> LD14049.complete
AAAAAACATACTGATTCAAATTTTTTCTTTTTTCGTTTTTTATCATAAGA
TTTAAAAAAAATTTAATTTTTTTCTCTTCTTTTGCTAGGGATAGTCGAAT
GTTTGTTTAAAAAATCATGTGGATTATCAATAAAAAATTTATATTCGATA
GGCTCGATTGAAAGACACCAGAAAATGCTGACCGCCGCACACGCCACTCG
ATTTATTCTTCATGCCTATCGAAAAAAGCCGTGGTGAGGTTCCGGCATCT
GTATTTTATTTACAAGCGATAGAATTAACATAGAAATCAAATAAAATGAC
GATCGGCAAGAACAACAAAATGATTCAGCACCTGAATTATCGGGTGCGAA
TCGTGCTGCAGGACTCGCGTACCTTCATCGGTACCTTCAAAGCCTTCGAC
AAACACATGAACTTGATCCTCGGCGACTGCGAGGAGTTCCGGAAGATTCG
CTCGAAGAATTCCAAGGTGCCCGAGCGCGAGGAGAAGCGCGTGCTGGGCT
TTGTATTGCTGCGCGGCGAGAACATAGTTTCACTGACGGTGGAGGGACCA
CCGCCGCCAGAGGAGGGCCTGCCCCGAGTTCCCATTCCGGGAGCAGCTCC
TGGTCCGGGAATCGGTCGCGTGGCCGGACGCGGAATGCCTATCAACTTGT
CCGCCGTGCCAGCGGGTCTCCAGGGTCCCGTGAGAGGTGTGGGCGGACCC
GCCCAACAGCACATGGCTCCGATGGGACGAGGAGTGCCACGAGCACCGAT
GATGGGTGCACCGCCACCGGGCATGATTCCCGGCGGCATGCCCTCGATGC
CAGGAAACATGGGACGCGGTGCTCCGCCACCGATGCGCGGACCGCCGCCC
AGCATGATCCGTGGAGCACCACCACCGGGCAGGGGTGGCTATTAAGTATA
AAGTACAATCTAATAAAAACTCATTTAGAAAACACCACTTAAAAAAAAAA
AAAAAAAAA

LD14049.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
SmB-RA 940 SmB-RA 1..940 1..940 4700 100 Plus
KdelR-RA 1672 KdelR-RA 1..146 146..1 730 100 Minus
KdelR.b 1938 KdelR.b 1..146 146..1 730 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10424314..10424956 940..298 3185 99.7 Minus
chr2L 23010047 chr2L 10425325..10425625 298..1 1335 97 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10425481..10426125 942..298 3225 100 Minus
2L 23513712 2L 10426494..10426791 298..1 1490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10425481..10426125 942..298 3225 100 Minus
2L 23513712 2L 10426494..10426791 298..1 1490 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:57:11 has no hits.

LD14049.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10424314..10424955 299..940 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:22 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RA 1..600 296..895 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:39 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RA 1..600 296..895 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RB 1..600 296..895 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:27 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RA 1..600 296..895 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:52:20 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RB 1..600 296..895 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:00 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:39 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RB 1..776 165..940 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:27 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RA 1..940 1..940 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:52:20 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
SmB-RB 1..776 165..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10425483..10426124 299..940 100 <- Minus
2L 10426494..10426791 1..298 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10425483..10426124 299..940 100 <- Minus
2L 10426494..10426791 1..298 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10425483..10426124 299..940 100 <- Minus
2L 10426494..10426791 1..298 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:11 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10425483..10426124 299..940 100 <- Minus
arm_2L 10426494..10426791 1..298 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:22 Download gff for LD14049.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10425483..10426124 299..940 100 <- Minus
2L 10426494..10426791 1..298 100   Minus

LD14049.hyp Sequence

Translation from 295 to 894

> LD14049.hyp
MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRK
IRSKNSKVPEREEKRVLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGA
APGPGIGRVAGRGMPINLSAVPAGLQGPVRGVGGPAQQHMAPMGRGVPRA
PMMGAPPPGMIPGGMPSMPGNMGRGAPPPMRGPPPSMIRGAPPPGRGGY*

LD14049.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
SmB-PB 199 CG5352-PB 1..199 1..199 1069 100 Plus

LD14049.pep Sequence

Translation from 295 to 894

> LD14049.pep
MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRK
IRSKNSKVPEREEKRVLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGA
APGPGIGRVAGRGMPINLSAVPAGLQGPVRGVGGPAQQHMAPMGRGVPRA
PMMGAPPPGMIPGGMPSMPGNMGRGAPPPMRGPPPSMIRGAPPPGRGGY*

LD14049.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14098-PA 199 GF14098-PA 1..199 1..199 833 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23931-PA 199 GG23931-PA 1..199 1..199 973 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13302-PA 198 GH13302-PA 1..198 1..199 799 94.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
SmB-PB 199 CG5352-PB 1..199 1..199 1069 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18165-PA 198 GI18165-PA 1..198 1..199 800 94 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19145-PA 205 GL19145-PA 8..205 2..199 822 92.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18820-PA 191 GA18820-PA 1..191 9..199 781 92.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11667-PA 199 GM11667-PA 1..199 1..199 972 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22258-PA 199 GD22258-PA 1..199 1..199 972 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14598-PA 198 GJ14598-PA 1..198 1..199 800 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14876-PA 191 GK14876-PA 1..191 9..199 778 95.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\SmB-PA 199 GE25943-PA 1..199 1..199 973 99 Plus