Clone LD14068 Report

Search the DGRC for LD14068

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:140
Well:68
Vector:pBS SK-
Associated Gene/TranscriptRtnl1-RB
Protein status:LD14068.pep: gold
Preliminary Size:1755
Sequenced Size:1526

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33113 2001-11-29 Blastp of sequenced clone
Rtnl1 2008-04-29 Release 5.5 accounting
Rtnl1 2008-08-15 Release 5.9 accounting
Rtnl1 2008-12-18 5.12 accounting

Clone Sequence Records

LD14068.complete Sequence

1526 bp (1526 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069432

> LD14068.complete
CATTTTAACTTTACACATTTGTGTATTATAACTACATATAACAATACCAT
CCTGACCGCAGATATAGAATTTATTTTAATTTTACTTGTGCGTTGTGTTG
ATCGGTAAACAAAGGCGGAAATCCGAAGAGTGGAGCCGAGTAAACAATTT
ACTGTCCAATAAAAAGGATAACTCGTAGTGCTAACGAAGAAGTGTGCTAA
GCAAAAAGCAAAACCCAAATTAAAACCAGCATAATGTCCGCATTTGGTGA
AACCGGTCAGAATGGCGTGTGCAAGCAGCGCCCATTGATTTGCTCCATAC
TCGATCCCAATGCCTGGTTTAAGCCCGAACGTTTGCACCCGCAAGTGGAA
TCCCTTATCTACTGGCGCGATGTGAAGAAATCCGGCATTGTCTTCGGCGC
TGGCCTGATCACACTGGCGGCCATCTCCAGCTTCTCGGTGATCAGCGTGT
TCGCCTACTTGTCGCTCCTAACCCTCTTCGGCACCGTCGCCTTCAGAATC
TACAAATCTGTGACACAGGCCGTGCAAAAGACAAACGAGGGTCACCCCTT
TAAGGATTACCTGGAGCTGGATCTGACGCTGTCGCACGAAAAGGTACAGA
ACATTGCCGGCGTGGCTGTGGCACATATCAATGGCTTCATCTCCGAGCTG
AGGCGTCTGTTTCTTGTTGAGGATATCATCGATTCGATCAAGTTCGGCGT
CATTCTGTGGGTCTTCACCTACGTGGGTGCCTGGTTCAATGGCATGACTC
TGGTCATCTTGGCCTTTGTCTCGCTGTTTACCTTGCCCAAGGTCTACGAG
AACAACAAGCAATCGATCGACACTCACTTGGATCTGGTGCGCAGCAAATT
GACAGAAATCACCGACAAGATCCGAGTGGCCATCCCCATTGGCAACAAGA
AGCCCGAGGCCGCTGCCGAGTCTGAGAAGGACAAGTAAAGAACCCGCACT
AGCAAGAGAAACAACCACAAATAAACATGTTTATTTATTTATTAAGCATT
ATTTGAATGGTTTTAATATTCATCCAGGCATTAAATAAATAACAAGTCTA
GCAGCAATGTTTACATATTAATTGTATAATTGCAATCAACATCAATCGAT
AATTGTAAATCAAATTTGAAGAGACCCAAAACAATTTATCAACCAACAAC
TCGTAGCAGTTTCAAACATTGTCCAAGTGTCTTTAAGTTTTTAACGAACG
AAACATTTAAAAAGCATATATAGTGAGGGAAATTAAGAAGAAAACGATTA
TATAGACGCAGCAATGCAAATAAATTTCTTATGAGTTCCACGCAATTTCC
GATTTGAATCAACTATCTTCATTTCGATTTATTCAGCTTTCTTAGTTTTC
ATGTGACCCTTTTTAAATTAATTCTTTGCTTTAGTTTTAGTTTTACTATT
TTGTTGATTTTTTGTATAAAACAACAAGAAGAACTAAGATTACTCTTAAA
AACAAACAAACAAGAAAAAATCAAATAAAAAATGAAGTAAAAATCCACAA
CTAATAAAAAAAAAAAAAAAAAAAAA

LD14068.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1.g 2311 Rtnl1.g 78..1582 1..1505 7525 100 Plus
Rtnl1-RB 1720 Rtnl1-RB 78..1582 1..1505 7525 100 Plus
Rtnl1-RI 1496 Rtnl1-RI 140..1496 149..1505 6785 100 Plus
Rtnl1-RI 1496 Rtnl1-RI 36..139 1..104 520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4992741..4993377 1505..869 3185 100 Minus
chr2L 23010047 chr2L 4993886..4994096 554..344 1055 100 Minus
chr2L 23010047 chr2L 4993608..4993816 762..554 1045 100 Minus
chr2L 23010047 chr2L 5003714..5003874 309..149 805 100 Minus
chr2L 23010047 chr2L 5005484..5005631 148..1 740 100 Minus
chr2L 23010047 chr2L 4993438..4993545 869..762 540 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4993641..4994277 1505..869 3185 100 Minus
2L 23513712 2L 4994786..4994996 554..344 1055 100 Minus
2L 23513712 2L 4994508..4994716 762..554 1045 100 Minus
2L 23513712 2L 5004614..5004774 309..149 805 100 Minus
2L 23513712 2L 5006384..5006531 148..1 740 100 Minus
2L 23513712 2L 4994338..4994445 869..762 540 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4993641..4994277 1505..869 3185 100 Minus
2L 23513712 2L 4994786..4994996 554..344 1055 100 Minus
2L 23513712 2L 4994508..4994716 762..554 1045 100 Minus
2L 23513712 2L 5004614..5004774 309..149 805 100 Minus
2L 23513712 2L 5006384..5006531 148..1 740 100 Minus
2L 23513712 2L 4994338..4994445 869..762 540 100 Minus
2L 23513712 2L 5004172..5004207 345..310 180 100 Minus
Blast to na_te.dros performed 2019-03-15 13:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 843..904 1041..981 118 67.7 Minus
gypsy5 7369 gypsy5 GYPSY5 7369bp 5753..5844 1235..1328 114 62.5 Plus

LD14068.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:33:10 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4992741..4993377 869..1505 100 <- Minus
chr2L 4993439..4993544 763..868 100 <- Minus
chr2L 4993608..4993816 554..762 100 <- Minus
chr2L 4993887..4994094 346..553 100 <- Minus
chr2L 5003272..5003307 310..345 100 <- Minus
chr2L 5003714..5003874 149..309 100 <- Minus
chr2L 5005484..5005631 1..148 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:17:46 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 1..705 234..938 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:23:53 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RI 1..705 234..938 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:03:34 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 1..705 234..938 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:50:34 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 1..705 234..938 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:32:32 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 1..705 234..938 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:17:45 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 33..1537 1..1505 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:23:53 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 36..1540 1..1505 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:03:34 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 35..1539 1..1505 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:50:34 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 33..1537 1..1505 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:32:32 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RB 35..1539 1..1505 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:33:10 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 346..553 100 <- Minus
2L 5004172..5004207 310..345 100 <- Minus
2L 5004614..5004774 149..309 100 <- Minus
2L 5006384..5006531 1..148 100   Minus
2L 4994508..4994716 554..762 100 <- Minus
2L 4993641..4994277 869..1505 100 <- Minus
2L 4994339..4994444 763..868 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:33:10 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 346..553 100 <- Minus
2L 5004172..5004207 310..345 100 <- Minus
2L 5004614..5004774 149..309 100 <- Minus
2L 5006384..5006531 1..148 100   Minus
2L 4994508..4994716 554..762 100 <- Minus
2L 4993641..4994277 869..1505 100 <- Minus
2L 4994339..4994444 763..868 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:33:10 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 346..553 100 <- Minus
2L 5004172..5004207 310..345 100 <- Minus
2L 5004614..5004774 149..309 100 <- Minus
2L 5006384..5006531 1..148 100   Minus
2L 4994508..4994716 554..762 100 <- Minus
2L 4993641..4994277 869..1505 100 <- Minus
2L 4994339..4994444 763..868 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:03:34 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5004614..5004774 149..309 100 <- Minus
arm_2L 5006384..5006531 1..148 100   Minus
arm_2L 4993641..4994277 869..1505 100 <- Minus
arm_2L 4994339..4994444 763..868 100 <- Minus
arm_2L 4994508..4994716 554..762 100 <- Minus
arm_2L 4994787..4994994 346..553 100 <- Minus
arm_2L 5004172..5004207 310..345 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:01 Download gff for LD14068.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4993641..4994277 869..1505 100 <- Minus
2L 4994339..4994444 763..868 100 <- Minus
2L 4994508..4994716 554..762 100 <- Minus
2L 4994787..4994994 346..553 100 <- Minus
2L 5004172..5004207 310..345 100 <- Minus
2L 5004614..5004774 149..309 100 <- Minus
2L 5006384..5006531 1..148 100   Minus

LD14068.pep Sequence

Translation from 233 to 937

> LD14068.pep
MSAFGETGQNGVCKQRPLICSILDPNAWFKPERLHPQVESLIYWRDVKKS
GIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKT
NEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIID
SIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLD
LVRSKLTEITDKIRVAIPIGNKKPEAAAESEKDK*

LD14068.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14162-PA 596 GF14162-PA 389..596 26..234 1014 91.9 Plus
Dana\GF17296-PA 259 GF17296-PA 5..185 24..203 265 32.8 Plus
Dana\GF10829-PA 294 GF10829-PA 19..182 22..189 233 36 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24328-PA 607 GG24328-PA 399..607 26..234 1054 95.7 Plus
Dere\GG25105-PA 246 GG25105-PA 3..165 38..199 222 31.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11424-PA 234 GH11424-PA 1..234 1..234 1110 88.9 Plus
Dgri\GH17123-PA 245 GH17123-PA 3..161 39..196 163 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PJ 234 CG33113-PJ 1..234 1..234 1192 100 Plus
Rtnl1-PI 234 CG33113-PI 1..234 1..234 1192 100 Plus
Rtnl1-PB 234 CG33113-PB 1..234 1..234 1192 100 Plus
Rtnl1-PE 234 CG33113-PE 1..234 1..234 1192 100 Plus
Rtnl1-PL 222 CG33113-PL 1..222 1..234 1093 94.4 Plus
Rtnl1-PH 607 CG33113-PH 399..607 26..234 1052 99.5 Plus
Rtnl1-PA 222 CG33113-PA 14..222 26..234 989 95.7 Plus
Rtnl1-PF 595 CG33113-PF 399..595 38..234 984 100 Plus
Rtnl1-PC 202 CG33113-PC 6..202 38..234 981 99.5 Plus
Rtnl1-PG 224 CG33113-PG 28..224 38..234 981 99.5 Plus
Rtnl1-PD 224 CG33113-PD 28..224 38..234 981 99.5 Plus
Rtnl2-PC 255 CG1279-PC 19..216 38..234 232 31.8 Plus
Rtnl2-PB 255 CG1279-PB 19..216 38..234 232 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14630-PA 234 GI14630-PA 1..234 1..234 1138 91.5 Plus
Dmoj\GI11728-PA 258 GI11728-PA 13..175 39..200 260 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26483-PA 571 GL26483-PA 375..571 38..234 964 93.4 Plus
Dper\GL12168-PA 319 GL12168-PA 25..190 37..199 217 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28881-PA 224 GA28881-PA 25..224 35..234 956 91.5 Plus
Dpse\GA11813-PA 298 GA11813-PA 2..164 37..196 218 29.4 Plus
Dpse\GA11813-PB 321 GA11813-PB 25..187 37..196 218 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18049-PA 234 GM18049-PA 1..234 1..234 1226 99.6 Plus
Dsec\GM10472-PA 238 GM10472-PA 3..205 38..234 217 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22669-PA 234 GD22669-PA 1..234 1..234 1226 99.6 Plus
Dsim\GD19473-PA 238 GD19473-PA 3..205 38..234 225 30 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17140-PA 236 GJ17140-PA 1..234 1..234 1131 90.2 Plus
Dvir\GJ11400-PA 265 GJ11400-PA 5..208 32..225 289 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24458-PA 587 GK24458-PA 377..585 26..234 1019 91.9 Plus
Dwil\GK11074-PA 247 GK11074-PA 12..179 34..200 292 35.7 Plus
Dwil\GK19145-PA 159 GK19145-PA 10..156 29..175 142 25.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18708-PA 234 GE18708-PA 1..234 1..234 1190 96.2 Plus
Dyak\GE25782-PA 264 GE25782-PA 18..224 37..234 241 30.6 Plus

LD14068.hyp Sequence

Translation from 233 to 937

> LD14068.hyp
MSAFGETGQNGVCKQRPLICSILDPNAWFKPERLHPQVESLIYWRDVKKS
GIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKT
NEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIID
SIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLD
LVRSKLTEITDKIRVAIPIGNKKPEAAAESEKDK*

LD14068.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PJ 234 CG33113-PJ 1..234 1..234 1192 100 Plus
Rtnl1-PI 234 CG33113-PI 1..234 1..234 1192 100 Plus
Rtnl1-PB 234 CG33113-PB 1..234 1..234 1192 100 Plus
Rtnl1-PE 234 CG33113-PE 1..234 1..234 1192 100 Plus
Rtnl1-PL 222 CG33113-PL 1..222 1..234 1093 94.4 Plus