Clone LD14173 Report

Search the DGRC for LD14173

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:141
Well:73
Vector:pBS SK-
Associated Gene/TranscriptCG8009-RB
Protein status:LD14173.pep: gold
Preliminary Size:959
Sequenced Size:788

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8009 2001-01-01 Release 2 assignment
CG8009 2003-01-01 Sim4 clustering to Release 3
CG8009 2003-01-15 Blastp of sequenced clone
CG8009 2008-04-29 Release 5.5 accounting
CG8009 2008-08-15 Release 5.9 accounting
CG8009 2008-12-18 5.12 accounting

Clone Sequence Records

LD14173.complete Sequence

788 bp (788 high quality bases) assembled on 2003-01-15

GenBank Submission: AY069435

> LD14173.complete
GAAAAGAAAGCTATGAGAACCTCATCAAATAATAATAATAAATACAATAA
TATTTAAACTGGACAAATTTAATCGCATTAAGACGGCCACGAGCTTTGAG
GAAATAGCTGCAATGGAACCGTCAGCCTGCGAAGATCTCAAGGCCTTCGA
GCGGCGCCTCACCGAAGTGGTTTCATCGTACCGTCCCTCGACGTTCCGCT
GGCGCAAGCTTCTTGCAGTTGTCCTTTCCGCCATGTCCATGTGCACCGCC
ATCAGCGCCTGGTACTGGCTACGCGATCCGCGCACCACCGTTGTACCGCT
AACGGAGTCCCTCTGGATTCATCCCGTCTTCACAGTCGCCACCCTAACAT
TGGTCGTCCTGTTCATCCTGGGCATACAGAAACTAGTCATAGCTCCGCAA
ATAATTACATCGAGAACGCGAATGGTACTGGGAGACTTTAATATGAGCTG
TGACGACACGGGGAAGCTGATACTCAAGCCGCGGCAAAGTAACAACAACA
GTACATGAGCACCGGCCAGCTTCCAGGACGTTTATTTAGTTAATTGCTAG
TTCCCTTACCCTTTTCTTTTTTCCTACATGTTGATTCGGACACCCTCGCT
TTGTAAGCGTATTTTTAAAGTACCTCTTATTTCTCCCCTACACATTTTGT
TTAATTATAGAAGCTCCTTTGTACAAAAAAACAAAAAGAAAAGAAATCAA
TTGTTAAGCTTTATGTGTTTCGTTAATGGCGTTACCCATCGCTGCCAAAT
ACACCAAGCGACATTTCAATAAAAAAAAAAAAAAAAAA

LD14173.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8009-RB 875 CG8009-RB 40..810 1..771 3855 100 Plus
CG8009.a 883 CG8009.a 308..872 207..771 2825 100 Plus
CG8009-RA 863 CG8009-RA 246..798 219..771 2765 100 Plus
CG8009.a 883 CG8009.a 43..248 1..206 1030 100 Plus
CG8009-RA 863 CG8009-RA 40..245 1..206 1030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10630603..10631020 353..770 2000 98.6 Plus
chr3L 24539361 chr3L 10629951..10630097 207..353 705 98.6 Plus
chr3L 24539361 chr3L 10629589..10629722 1..134 655 99.3 Plus
chr3L 24539361 chr3L 10629818..10629891 133..206 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10639214..10639632 353..771 2095 100 Plus
3L 28110227 3L 10638554..10638700 207..353 735 100 Plus
3L 28110227 3L 10638192..10638325 1..134 670 100 Plus
3L 28110227 3L 10638421..10638494 133..206 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10632314..10632732 353..771 2095 100 Plus
3L 28103327 3L 10631654..10631800 207..353 735 100 Plus
3L 28103327 3L 10631292..10631425 1..134 670 100 Plus
3L 28103327 3L 10631521..10631594 133..206 370 100 Plus
Blast to na_te.dros performed 2019-03-16 19:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy8 4955 gypsy8 GYPSY8 4955bp 939..977 196..159 111 79.5 Minus

LD14173.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:15:22 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10629589..10629722 1..134 99 -> Plus
chr3L 10629820..10629891 135..206 100 -> Plus
chr3L 10629951..10630097 207..353 98 -> Plus
chr3L 10630604..10631020 354..770 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:31 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 1..396 113..508 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:21 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 1..396 113..508 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:32 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 1..396 113..508 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:25 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 1..396 113..508 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:24:56 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 1..396 113..508 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:46 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 40..809 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:21 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 40..809 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:32 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 47..816 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:26 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 40..809 1..770 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:24:56 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
CG8009-RB 47..816 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:22 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10638192..10638325 1..134 100 -> Plus
3L 10638423..10638494 135..206 100 -> Plus
3L 10638554..10638700 207..353 100 -> Plus
3L 10639215..10639631 354..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:22 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10638192..10638325 1..134 100 -> Plus
3L 10638423..10638494 135..206 100 -> Plus
3L 10638554..10638700 207..353 100 -> Plus
3L 10639215..10639631 354..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:22 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10638192..10638325 1..134 100 -> Plus
3L 10638423..10638494 135..206 100 -> Plus
3L 10638554..10638700 207..353 100 -> Plus
3L 10639215..10639631 354..770 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:32 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10631292..10631425 1..134 100 -> Plus
arm_3L 10631523..10631594 135..206 100 -> Plus
arm_3L 10631654..10631800 207..353 100 -> Plus
arm_3L 10632315..10632731 354..770 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:10:28 Download gff for LD14173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10632315..10632731 354..770 100   Plus
3L 10631654..10631800 207..353 100 -> Plus
3L 10631292..10631425 1..134 100 -> Plus
3L 10631523..10631594 135..206 100 -> Plus

LD14173.hyp Sequence

Translation from 112 to 507

> LD14173.hyp
MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAW
YWLRDPRTTVVPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITS
RTRMVLGDFNMSCDDTGKLILKPRQSNNNST*

LD14173.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8009-PB 131 CG8009-PB 1..131 1..131 673 100 Plus
CG8009-PA 127 CG8009-PA 1..127 1..131 640 96.2 Plus
CG41106-PA 123 CG41106-PA 1..122 1..126 189 36.5 Plus

LD14173.pep Sequence

Translation from 112 to 507

> LD14173.pep
MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAW
YWLRDPRTTVVPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITS
RTRMVLGDFNMSCDDTGKLILKPRQSNNNST*

LD14173.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10599-PA 127 GF10599-PA 1..127 1..131 630 92.4 Plus
Dana\GF22019-PA 125 GF22019-PA 5..122 1..123 200 35.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15442-PA 127 GG15442-PA 1..127 1..131 638 93.1 Plus
Dere\GG19757-PA 123 GG19757-PA 1..123 1..127 207 37 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14952-PA 130 GH14952-PA 1..127 1..130 538 80.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8009-PB 131 CG8009-PB 1..131 1..131 673 100 Plus
CG8009-PA 127 CG8009-PA 1..127 1..131 640 96.2 Plus
CG41106-PA 123 CG41106-PA 1..122 1..126 189 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes100-PA 159 GI11479-PA 1..125 1..128 535 78.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15473-PA 131 GL15473-PA 1..131 1..131 630 90.8 Plus
Dper\GL23141-PA 126 GL23141-PA 1..126 1..131 512 75.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23834-PA 131 GA23834-PA 1..131 1..131 632 90.8 Plus
Dpse\GA27154-PA 126 GA27154-PA 1..126 1..131 508 75.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25217-PA 127 GM25217-PA 1..127 1..131 650 96.2 Plus
Dsec\GM10063-PA 123 GM10063-PA 1..123 1..127 206 37 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17576-PA 123 GD17576-PA 1..123 1..127 206 37 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13672-PA 129 GJ13672-PA 1..127 1..130 549 81.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12275-PA 127 GK12275-PA 1..127 1..131 623 89.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21752-PA 127 GE21752-PA 1..127 1..131 640 93.9 Plus
Dyak\GE17951-PA 1425 GE17951-PA 1303..1424 1..126 205 38.1 Plus