BDGP Sequence Production Resources |
Search the DGRC for LD14173
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 141 |
Well: | 73 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG8009-RB |
Protein status: | LD14173.pep: gold |
Preliminary Size: | 959 |
Sequenced Size: | 788 |
Gene | Date | Evidence |
---|---|---|
CG8009 | 2001-01-01 | Release 2 assignment |
CG8009 | 2003-01-01 | Sim4 clustering to Release 3 |
CG8009 | 2003-01-15 | Blastp of sequenced clone |
CG8009 | 2008-04-29 | Release 5.5 accounting |
CG8009 | 2008-08-15 | Release 5.9 accounting |
CG8009 | 2008-12-18 | 5.12 accounting |
788 bp (788 high quality bases) assembled on 2003-01-15
GenBank Submission: AY069435
> LD14173.complete GAAAAGAAAGCTATGAGAACCTCATCAAATAATAATAATAAATACAATAA TATTTAAACTGGACAAATTTAATCGCATTAAGACGGCCACGAGCTTTGAG GAAATAGCTGCAATGGAACCGTCAGCCTGCGAAGATCTCAAGGCCTTCGA GCGGCGCCTCACCGAAGTGGTTTCATCGTACCGTCCCTCGACGTTCCGCT GGCGCAAGCTTCTTGCAGTTGTCCTTTCCGCCATGTCCATGTGCACCGCC ATCAGCGCCTGGTACTGGCTACGCGATCCGCGCACCACCGTTGTACCGCT AACGGAGTCCCTCTGGATTCATCCCGTCTTCACAGTCGCCACCCTAACAT TGGTCGTCCTGTTCATCCTGGGCATACAGAAACTAGTCATAGCTCCGCAA ATAATTACATCGAGAACGCGAATGGTACTGGGAGACTTTAATATGAGCTG TGACGACACGGGGAAGCTGATACTCAAGCCGCGGCAAAGTAACAACAACA GTACATGAGCACCGGCCAGCTTCCAGGACGTTTATTTAGTTAATTGCTAG TTCCCTTACCCTTTTCTTTTTTCCTACATGTTGATTCGGACACCCTCGCT TTGTAAGCGTATTTTTAAAGTACCTCTTATTTCTCCCCTACACATTTTGT TTAATTATAGAAGCTCCTTTGTACAAAAAAACAAAAAGAAAAGAAATCAA TTGTTAAGCTTTATGTGTTTCGTTAATGGCGTTACCCATCGCTGCCAAAT ACACCAAGCGACATTTCAATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8009-RB | 875 | CG8009-RB | 40..810 | 1..771 | 3855 | 100 | Plus |
CG8009.a | 883 | CG8009.a | 308..872 | 207..771 | 2825 | 100 | Plus |
CG8009-RA | 863 | CG8009-RA | 246..798 | 219..771 | 2765 | 100 | Plus |
CG8009.a | 883 | CG8009.a | 43..248 | 1..206 | 1030 | 100 | Plus |
CG8009-RA | 863 | CG8009-RA | 40..245 | 1..206 | 1030 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 10630603..10631020 | 353..770 | 2000 | 98.6 | Plus |
chr3L | 24539361 | chr3L | 10629951..10630097 | 207..353 | 705 | 98.6 | Plus |
chr3L | 24539361 | chr3L | 10629589..10629722 | 1..134 | 655 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 10629818..10629891 | 133..206 | 370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 10639214..10639632 | 353..771 | 2095 | 100 | Plus |
3L | 28110227 | 3L | 10638554..10638700 | 207..353 | 735 | 100 | Plus |
3L | 28110227 | 3L | 10638192..10638325 | 1..134 | 670 | 100 | Plus |
3L | 28110227 | 3L | 10638421..10638494 | 133..206 | 370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 10632314..10632732 | 353..771 | 2095 | 100 | Plus |
3L | 28103327 | 3L | 10631654..10631800 | 207..353 | 735 | 100 | Plus |
3L | 28103327 | 3L | 10631292..10631425 | 1..134 | 670 | 100 | Plus |
3L | 28103327 | 3L | 10631521..10631594 | 133..206 | 370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy8 | 4955 | gypsy8 GYPSY8 4955bp | 939..977 | 196..159 | 111 | 79.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 10629589..10629722 | 1..134 | 99 | -> | Plus |
chr3L | 10629820..10629891 | 135..206 | 100 | -> | Plus |
chr3L | 10629951..10630097 | 207..353 | 98 | -> | Plus |
chr3L | 10630604..10631020 | 354..770 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 1..396 | 113..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 1..396 | 113..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 1..396 | 113..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 1..396 | 113..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 1..396 | 113..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 40..809 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 40..809 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 47..816 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 40..809 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8009-RB | 47..816 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10638192..10638325 | 1..134 | 100 | -> | Plus |
3L | 10638423..10638494 | 135..206 | 100 | -> | Plus |
3L | 10638554..10638700 | 207..353 | 100 | -> | Plus |
3L | 10639215..10639631 | 354..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10638192..10638325 | 1..134 | 100 | -> | Plus |
3L | 10638423..10638494 | 135..206 | 100 | -> | Plus |
3L | 10638554..10638700 | 207..353 | 100 | -> | Plus |
3L | 10639215..10639631 | 354..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10638192..10638325 | 1..134 | 100 | -> | Plus |
3L | 10638423..10638494 | 135..206 | 100 | -> | Plus |
3L | 10638554..10638700 | 207..353 | 100 | -> | Plus |
3L | 10639215..10639631 | 354..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 10631292..10631425 | 1..134 | 100 | -> | Plus |
arm_3L | 10631523..10631594 | 135..206 | 100 | -> | Plus |
arm_3L | 10631654..10631800 | 207..353 | 100 | -> | Plus |
arm_3L | 10632315..10632731 | 354..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10632315..10632731 | 354..770 | 100 | Plus | |
3L | 10631654..10631800 | 207..353 | 100 | -> | Plus |
3L | 10631292..10631425 | 1..134 | 100 | -> | Plus |
3L | 10631523..10631594 | 135..206 | 100 | -> | Plus |
Translation from 112 to 507
> LD14173.hyp MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAW YWLRDPRTTVVPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITS RTRMVLGDFNMSCDDTGKLILKPRQSNNNST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8009-PB | 131 | CG8009-PB | 1..131 | 1..131 | 673 | 100 | Plus |
CG8009-PA | 127 | CG8009-PA | 1..127 | 1..131 | 640 | 96.2 | Plus |
CG41106-PA | 123 | CG41106-PA | 1..122 | 1..126 | 189 | 36.5 | Plus |
Translation from 112 to 507
> LD14173.pep MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAW YWLRDPRTTVVPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITS RTRMVLGDFNMSCDDTGKLILKPRQSNNNST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10599-PA | 127 | GF10599-PA | 1..127 | 1..131 | 630 | 92.4 | Plus |
Dana\GF22019-PA | 125 | GF22019-PA | 5..122 | 1..123 | 200 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15442-PA | 127 | GG15442-PA | 1..127 | 1..131 | 638 | 93.1 | Plus |
Dere\GG19757-PA | 123 | GG19757-PA | 1..123 | 1..127 | 207 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14952-PA | 130 | GH14952-PA | 1..127 | 1..130 | 538 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8009-PB | 131 | CG8009-PB | 1..131 | 1..131 | 673 | 100 | Plus |
CG8009-PA | 127 | CG8009-PA | 1..127 | 1..131 | 640 | 96.2 | Plus |
CG41106-PA | 123 | CG41106-PA | 1..122 | 1..126 | 189 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\Tes100-PA | 159 | GI11479-PA | 1..125 | 1..128 | 535 | 78.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15473-PA | 131 | GL15473-PA | 1..131 | 1..131 | 630 | 90.8 | Plus |
Dper\GL23141-PA | 126 | GL23141-PA | 1..126 | 1..131 | 512 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23834-PA | 131 | GA23834-PA | 1..131 | 1..131 | 632 | 90.8 | Plus |
Dpse\GA27154-PA | 126 | GA27154-PA | 1..126 | 1..131 | 508 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25217-PA | 127 | GM25217-PA | 1..127 | 1..131 | 650 | 96.2 | Plus |
Dsec\GM10063-PA | 123 | GM10063-PA | 1..123 | 1..127 | 206 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17576-PA | 123 | GD17576-PA | 1..123 | 1..127 | 206 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13672-PA | 129 | GJ13672-PA | 1..127 | 1..130 | 549 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12275-PA | 127 | GK12275-PA | 1..127 | 1..131 | 623 | 89.3 | Plus |