Clone LD14189 Report

Search the DGRC for LD14189

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:141
Well:89
Vector:pBS SK-
Associated Gene/TranscriptrdgBbeta-RA
Protein status:LD14189.pep: gold
Preliminary Size:1367
Sequenced Size:1367

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17818 2001-01-01 Release 2 assignment
CG17818 2002-12-11 Blastp of sequenced clone
CG17818 2003-01-01 Sim4 clustering to Release 3
rdgBbeta 2008-04-29 Release 5.5 accounting
rdgBbeta 2008-08-15 Release 5.9 accounting
rdgBbeta 2008-12-18 5.12 accounting

Clone Sequence Records

LD14189.complete Sequence

1367 bp (1367 high quality bases) assembled on 2002-12-11

GenBank Submission: AF160934

> LD14189.complete
CGCGTGTGTGTCTCTTTGCGTAACGTTCAAAGTTTTGATTTGTATTTTCT
CCGGCATACAAATCCGCCAAAGAAATGGTGCTAATCAAGGAGTATCGCGT
ATGCATGCCGCTTACGGTGGAGGAGTACAAGATCGGACAGCTTTATATGA
TAGCGCGCCACAGTCTGGAGCAATCGGAGGAGGGCGAGGGCGTTGAGGTG
GTGGAGAACAAGCCCTGCGAGGATCCCGTTCACGGCAAGGGCCAGTACAC
GGAGAAGCACATTCACTTGTCCAGCCGACTGCCCTACTGGATCCAGGCCA
TTTGCCCCCGAGTCTTCTATGTGATAGAGAAATCATGGAACTACTATCCG
TACACGCTAACAGAATACACGTGTTCCTTTATACCCAAACTAAATGTGCT
CATCAAAACTAAGTACGAGGACAATAATGGCAGCACAGAAAACTGTCTGG
ATCTTACTGAAGATGAGCTCAAAGTTCGAACTGTGGATCATTTGGACATA
GCGTTCGATGAGGTCAGTGCCAAGCATTATAAGAAGGAAGAAGATCCCAA
GTTCTTCAAATCCGAAAAGACAAACCGTGGTCCATTGATTGAAGGATGGC
GGGAAACGGACAAGCCCATTATGTGCTCCTACAAGGTGGTCCACGCCAGC
TTTGAGGTATGGGGTCTGCAGACCAAAGTGGAGGACTTCATTCAGCGCGG
AATTCGGGAGATTCTACTACTGGGACACCGGCAGGCTTTCGCATGGGTGG
ACGAATGGCATGGCATGACCCTGGAGGATGTTCGCGCCTACGAGCGTCAA
AAGCAGGCCGAGACCAATGAGAAGATTCACAACACAAGTGGTGGCGCAAA
TGCAGCGGCCAACGCCAAAGAGGCAAATGATGGCGATATTGATTGAGAAT
TTACCTAAAATGTAGGAAAATCGAAGTAACAAAATGCAGGCTAAAATAGT
ACCTTCAAGGCCTCGCGGCAAGCTTAAAAAGTTTCATAGGAAATATCTTA
TTAACGTACGCATATTTATGTATATACATACATATATATATATCATTGTC
TATGCATTTCTATGGTCCAAAGAAGCTCAGAGCTCTAGTAACTGCCTGCA
GCGTTTAAAAGTACAATGCACAAGCACCTAGCTGGAAACTCGAAACCAAA
TAATTGTTACAAACTAGATCACGCAATTTTTTAGTCAAACTTATAAGCGT
TACACAGACATCCTAGTGAACGGTTTGCGTTAACTATATTCCCTAGTTTA
GCTCACATCTAAATGTATATTTTGGTGTACAAATACAAACAATTTTGGTG
TACAAATACAAACGATTAAACATATTAGAAATATACCTATGTCATATGAA
AAAAAAAAAAAAAAAAA

LD14189.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
rdgBbeta-RA 1823 rdgBbeta-RA 417..1765 1..1349 6745 100 Plus
rdgBbeta.a 1082 rdgBbeta.a 96..1082 362..1348 4935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13582890..13583664 1348..574 3860 99.9 Minus
chr2R 21145070 chr2R 13585099..13585249 274..124 755 100 Minus
chr2R 21145070 chr2R 13583726..13583855 573..444 650 100 Minus
chr2R 21145070 chr2R 13585318..13585442 125..1 625 100 Minus
chr2R 21145070 chr2R 13584946..13585037 363..272 460 100 Minus
chr2R 21145070 chr2R 13583915..13583987 443..371 365 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17695775..17696550 1349..574 3880 100 Minus
2R 25286936 2R 17697985..17698135 274..124 755 100 Minus
2R 25286936 2R 17696612..17696741 573..444 650 100 Minus
2R 25286936 2R 17698204..17698328 125..1 625 100 Minus
2R 25286936 2R 17697832..17697923 363..272 460 100 Minus
2R 25286936 2R 17696801..17696873 443..371 365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17696974..17697749 1349..574 3880 100 Minus
2R 25260384 2R 17699184..17699334 274..124 755 100 Minus
2R 25260384 2R 17697811..17697940 573..444 650 100 Minus
2R 25260384 2R 17699403..17699527 125..1 625 100 Minus
2R 25260384 2R 17699031..17699122 363..272 460 100 Minus
2R 25260384 2R 17698000..17698072 443..371 365 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:15:40 has no hits.

LD14189.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:16:41 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13582890..13583664 574..1348 95 <- Minus
chr2R 13583726..13583855 444..573 100 <- Minus
chr2R 13583915..13583986 372..443 100 <- Minus
chr2R 13584939..13585034 275..371 93 <- Minus
chr2R 13585099..13585247 126..274 100 <- Minus
chr2R 13585318..13585442 1..125 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:35 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 1..822 75..896 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:59:47 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 1..822 75..896 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:47 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 1..822 75..896 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:23 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 1..822 75..896 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:25:18 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 1..822 75..896 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:16:48 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 34..1381 1..1348 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:59:47 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 34..1381 1..1348 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:47 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 35..1382 1..1348 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:23 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 34..1381 1..1348 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:25:18 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
rdgBbeta-RA 35..1382 1..1348 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:41 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17695776..17696550 574..1348 100 <- Minus
2R 17696612..17696741 444..573 100 <- Minus
2R 17696801..17696872 372..443 100 <- Minus
2R 17697825..17697920 275..371 93 <- Minus
2R 17697985..17698133 126..274 100 <- Minus
2R 17698204..17698328 1..125 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:41 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17695776..17696550 574..1348 100 <- Minus
2R 17696612..17696741 444..573 100 <- Minus
2R 17696801..17696872 372..443 100 <- Minus
2R 17697825..17697920 275..371 93 <- Minus
2R 17697985..17698133 126..274 100 <- Minus
2R 17698204..17698328 1..125 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:41 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17695776..17696550 574..1348 100 <- Minus
2R 17696612..17696741 444..573 100 <- Minus
2R 17696801..17696872 372..443 100 <- Minus
2R 17697825..17697920 275..371 93 <- Minus
2R 17697985..17698133 126..274 100 <- Minus
2R 17698204..17698328 1..125 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:47 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13585490..13585638 126..274 100 <- Minus
arm_2R 13585709..13585833 1..125 100   Minus
arm_2R 13583281..13584055 574..1348 100 <- Minus
arm_2R 13584117..13584246 444..573 100 <- Minus
arm_2R 13584306..13584377 372..443 100 <- Minus
arm_2R 13585330..13585425 275..371 93 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:06 Download gff for LD14189.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17697811..17697940 444..573 100 <- Minus
2R 17698000..17698071 372..443 100 <- Minus
2R 17699024..17699119 275..371 93 <- Minus
2R 17699184..17699332 126..274 100 <- Minus
2R 17699403..17699527 1..125 100   Minus
2R 17696975..17697749 574..1348 100 <- Minus

LD14189.hyp Sequence

Translation from 74 to 392

> LD14189.hyp
MVLIKEYRVCMPLTVEEYKIGQLYMIARHSLEQSEEGEGVEVVENKPCED
PVHGKGQYTEKHIHLSSRLPYWIQAICPRVFYVIEKSWNYYPYTLTGEDV
PLYPN*

LD14189.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
rdgBbeta-PA 273 CG17818-PA 1..96 1..96 525 100 Plus
rdgB-PG 1237 CG11111-PG 1..102 2..101 264 52 Plus
rdgB-PE 1241 CG11111-PE 1..102 2..101 264 52 Plus
rdgB-PF 1250 CG11111-PF 1..102 2..101 264 52 Plus
rdgB-PB 1250 CG11111-PB 1..102 2..101 264 52 Plus

LD14189.pep Sequence

Translation from 74 to 895

> LD14189.pep
MVLIKEYRVCMPLTVEEYKIGQLYMIARHSLEQSEEGEGVEVVENKPCED
PVHGKGQYTEKHIHLSSRLPYWIQAICPRVFYVIEKSWNYYPYTLTEYTC
SFIPKLNVLIKTKYEDNNGSTENCLDLTEDELKVRTVDHLDIAFDEVSAK
HYKKEEDPKFFKSEKTNRGPLIEGWRETDKPIMCSYKVVHASFEVWGLQT
KVEDFIQRGIREILLLGHRQAFAWVDEWHGMTLEDVRAYERQKQAETNEK
IHNTSGGANAAANAKEANDGDID*

LD14189.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13233-PA 276 GF13233-PA 1..274 1..273 1304 92 Plus
Dana\GF22606-PA 1254 GF22606-PA 1..267 2..251 620 46.4 Plus
Dana\GF18473-PA 272 GF18473-PA 3..257 4..249 499 42 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21028-PA 263 GG21028-PA 1..262 1..272 1309 90.1 Plus
Dere\GG17812-PA 1258 GG17812-PA 1..267 2..251 608 45.7 Plus
Dere\GG16119-PA 272 GG16119-PA 3..257 4..249 520 43.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20541-PA 274 GH20541-PA 1..264 1..264 1296 89 Plus
Dgri\GH17761-PA 1306 GH17761-PA 1..267 2..251 614 45.7 Plus
Dgri\GH14846-PA 272 GH14846-PA 3..257 4..249 503 42 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
rdgBbeta-PA 273 CG17818-PA 1..273 1..273 1471 100 Plus
rdgB-PG 1237 CG11111-PG 1..267 2..251 607 45.7 Plus
rdgB-PE 1241 CG11111-PE 1..267 2..251 607 45.7 Plus
rdgB-PF 1250 CG11111-PF 1..267 2..251 607 45.7 Plus
rdgB-PB 1250 CG11111-PB 1..267 2..251 607 45.7 Plus
rdgB-PA 1259 CG11111-PA 1..267 2..251 607 45.7 Plus
rdgB-PD 1259 CG11111-PD 1..267 2..251 607 45.7 Plus
rdgB-PC 1259 CG11111-PC 1..267 2..251 607 45.7 Plus
rdgB-PH 1263 CG11111-PH 1..267 2..251 607 45.7 Plus
rdgB-PI 1277 CG11111-PI 1..267 2..251 607 45.7 Plus
rdgB-PK 1284 CG11111-PK 1..267 2..251 607 45.7 Plus
rdgB-PJ 1297 CG11111-PJ 1..267 2..251 607 45.7 Plus
vib-PC 272 CG5269-PC 3..257 4..249 521 43.5 Plus
vib-PA 272 CG5269-PA 3..257 4..249 521 43.5 Plus
vib-PB 273 CG5269-PB 3..258 4..249 507 43 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18810-PA 273 GI18810-PA 1..252 1..252 1278 91.7 Plus
Dmoj\GI15095-PA 1249 GI15095-PA 1..267 2..251 625 46.4 Plus
Dmoj\GI23689-PA 272 GI23689-PA 3..257 4..249 498 42 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17678-PA 276 GL17678-PA 1..276 1..273 1228 84.8 Plus
Dper\GL19870-PA 1281 GL19870-PA 1..267 2..251 616 46.1 Plus
Dper\GL11977-PA 272 GL11977-PA 3..257 4..249 502 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14679-PA 276 GA14679-PA 1..276 1..273 1226 85.1 Plus
Dpse\GA10766-PA 1260 GA10766-PA 1..267 2..251 614 46.1 Plus
Dpse\GA18775-PA 272 GA18775-PA 3..257 4..249 502 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19958-PA 275 GM19958-PA 1..275 1..273 1427 97.1 Plus
Dsec\GM17640-PA 1236 GM17640-PA 1..267 2..251 612 45.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25449-PA 266 GD25449-PA 1..266 1..273 1366 94.2 Plus
Dsim\GD20127-PA 272 GD20127-PA 3..257 4..249 520 43.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21837-PA 279 GJ21837-PA 1..268 1..268 1285 88.1 Plus
Dvir\GJ18902-PA 1247 GJ18902-PA 1..267 2..251 617 46.1 Plus
Dvir\GJ23248-PA 272 GJ23248-PA 3..257 4..249 498 42.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21738-PA 269 GK21738-PA 1..253 1..253 1217 86.2 Plus
Dwil\GK16248-PA 1296 GK16248-PA 1..281 2..265 626 44.5 Plus
Dwil\GK13484-PA 272 GK13484-PA 3..257 4..249 511 42.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13971-PA 268 GE13971-PA 1..268 1..273 1408 96.3 Plus
Dyak\GE17108-PA 1258 GE17108-PA 1..267 2..251 606 46.1 Plus
Dyak\GE25145-PA 272 GE25145-PA 3..257 4..249 521 43.5 Plus