Clone LD14261 Report

Search the DGRC for LD14261

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:142
Well:61
Vector:pBS SK-
Associated Gene/Transcriptscaf6-RC
Protein status:LD14261.pep: gold
Preliminary Size:650
Sequenced Size:1423

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6615 2002-01-01 Sim4 clustering to Release 2
CG6615 2003-01-01 Sim4 clustering to Release 3
scaf6 2008-04-29 Release 5.5 accounting
scaf6 2008-08-15 Release 5.9 accounting
scaf6 2008-12-18 5.12 accounting

Clone Sequence Records

LD14261.complete Sequence

1423 bp (1423 high quality bases) assembled on 2003-02-27

GenBank Submission: BT006010

> LD14261.complete
AAAAAACAAGAAGAAGCAGTGAAAAGTGCCGCTGAAAAAGTGCAAAAAGT
TATGAATTTAGTATTTTACATAGGATAATAGTGCTAATAACAGTCGCAAA
ATGGACGTGCAACCGCCACGCGATGCCAGTTTACGAAATATTATCGACAA
ACTGGCGGAGTTTGTGGCCAGAAATGGGCCGGAATTCGAGGCGATAACCA
AGCAGAAGCAGCAGAACAATCCAAAGTTCGAGTTCCTCTACGGCGGGGAG
TTCGCCAACTATTATCAATTCAGGGTGGCAGCGGAACAAGCTCTGCTAAA
GCAACAGGCCATTAACCAACAACTGCCACCAGGTGCTCCATCCGGCCACT
ACATGCAACATCCGCCGCCAATGCAGCAATCCCAACCACCGGGCCTCTAT
CCGCCACCCAATCAGCAGCCACCGCACCCGCCCGAAACCGCACAAGACAA
TATGCAACAGCAAACACAGCACTCCTGGCCGCCGAACTCCGGCAACGGTG
GGCCGCCAAACAATCAGCAGGCCAATGGCAATCCCATGGCCATGAATCTA
ACGTCACAACTGGAAGCCATCAAGATGCAGCAGAAGTCGCTGCGGGAACA
GATCCAGCAATCCGAAGCGAATCTCTCCGCACAGCACACGGTAATTTGAA
GTTGGAAATAACTGGGATACCTCTATATGCCCACCTTTGCAAGCCTTTTT
CCGAAAGATTAGAGCAGCTCGAGTGTATAAAGAAAAGATTTCAATATGAT
TTCATGTTGAATGTTGGCCTCCTCTGGCAAAAATTTAAAGAAGCAAATTG
GTTTCCTTTTTAAACTAAATACCCACCTAAAAGTTGCTTTTATAGTCTGA
ATATAAGAACGTGTTTGCTTCTTCGAATTTTTGACCTCCCTTTTAAACGA
CCCAATCGAATGTGAATATACCTCGATTTTAAGCCAGAATGCTTTTAATT
ATTTTCTTAAGAGAGAAGATAACTTGTATAACCCTTATATACTTTCGGAC
TTAAATGATTTCCAAAGATATTGTCATAGACTCATAGATGGCAGTTTTGT
ATTCCCTAGTTTTTGTAATAACAACTCTGGAACAAGAGTTCATCAAATGG
TGTTTAATATTAATAATTATGAACTGCTTTTGTGGACTTTTCACTCTATA
AGTACTGTGAACTAAATTCTTTCTAATAAGAAGGACATTTCTTATTGCTT
GTCGCTATTGAATTTCCCTGTAATGGAAGTGACTTCCCTCTTGAAATTGT
TTCTTATGAAACTAATCCACGAATTCCTCAGAATAATCAATCCTGCTCTC
GACCCTTTTCCAAATGTTTTTTCAATCGATCTACTCAGTTCTTGTTCTCC
AAGTGCGGATAAGATAAAGTTAAAGTGTACTTTCAGCAATATCAAACTAC
AAAAAAAAAAAAAAAAAAAAAAA

LD14261.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
scaf6-RC 1463 scaf6-RC 1..1402 1..1402 7010 100 Plus
scaf6-RA 3200 scaf6-RA 145..785 1..641 3205 100 Plus
scaf6-RB 1087 scaf6-RB 1..641 1..641 3205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17030389..17031504 1400..294 5290 98.5 Minus
chr3L 24539361 chr3L 17031567..17031738 293..122 860 100 Minus
chr3L 24539361 chr3L 17031902..17032023 122..1 610 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17040932..17042040 1402..294 5545 100 Minus
3L 28110227 3L 17042103..17042274 293..122 860 100 Minus
3L 28110227 3L 17042438..17042559 122..1 610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17034032..17035140 1402..294 5545 100 Minus
3L 28103327 3L 17035203..17035374 293..122 860 100 Minus
3L 28103327 3L 17035538..17035659 122..1 610 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:11:55 has no hits.

LD14261.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:12:40 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17030389..17031504 294..1400 98 <- Minus
chr3L 17031567..17031737 123..293 100 <- Minus
chr3L 17031902..17032023 1..122 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:39 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RA 1..541 101..641 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:18 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RC 1..549 101..649 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:59:36 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RC 1..549 101..649 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:44 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RA 1..541 101..641 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:03:46 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RC 1..549 101..649 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:11 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RB 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:17 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RC 1..1400 1..1400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:59:36 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RC 16..1415 1..1400 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:44 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RB 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:03:46 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
scaf6-RC 16..1415 1..1400 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:12:40 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17040934..17042040 294..1400 100 <- Minus
3L 17042103..17042273 123..293 100 <- Minus
3L 17042438..17042559 1..122 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:12:40 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17040934..17042040 294..1400 100 <- Minus
3L 17042103..17042273 123..293 100 <- Minus
3L 17042438..17042559 1..122 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:12:40 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17040934..17042040 294..1400 100 <- Minus
3L 17042103..17042273 123..293 100 <- Minus
3L 17042438..17042559 1..122 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:59:36 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17034034..17035140 294..1400 100 <- Minus
arm_3L 17035203..17035373 123..293 100 <- Minus
arm_3L 17035538..17035659 1..122 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:01 Download gff for LD14261.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17035538..17035659 1..122 100   Minus
3L 17034034..17035140 294..1400 100 <- Minus
3L 17035203..17035373 123..293 100 <- Minus

LD14261.hyp Sequence

Translation from 100 to 648

> LD14261.hyp
MDVQPPRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGE
FANYYQFRVAAEQALLKQQAINQQLPPGAPSGHYMQHPPPMQQSQPPGLY
PPPNQQPPHPPETAQDNMQQQTQHSWPPNSGNGGPPNNQQANGNPMAMNL
TSQLEAIKMQQKSLREQIQQSEANLSAQHTVI*

LD14261.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
scaf6-PC 182 CG33522-PC 1..182 1..182 978 100 Plus
scaf6-PE 251 CG33522-PE 1..182 1..182 972 98.9 Plus
scaf6-PA 960 CG33522-PA 1..182 1..182 972 98.9 Plus
CG16941-PA 784 CG16941-PA 29..84 3..59 150 53.4 Plus

LD14261.pep Sequence

Translation from 100 to 648

> LD14261.pep
MDVQPPRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGE
FANYYQFRVAAEQALLKQQAINQQLPPGAPSGHYMQHPPPMQQSQPPGLY
PPPNQQPPHPPETAQDNMQQQTQHSWPPNSGNGGPPNNQQANGNPMAMNL
TSQLEAIKMQQKSLREQIQQSEANLSAQHTVI*

LD14261.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24403-PA 979 GF24403-PA 1..172 1..182 604 74.6 Plus
Dana\GF17916-PA 792 GF17916-PA 35..84 11..59 155 58 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15832-PA 953 GG15832-PA 1..180 1..182 711 90.7 Plus
Dere\GG16800-PA 792 GG16800-PA 35..84 11..59 154 58 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15948-PA 1039 GH15948-PA 1..194 1..182 508 60 Plus
Dgri\GH18068-PA 799 GH18068-PA 35..84 11..59 154 58 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
scaf6-PC 182 CG33522-PC 1..182 1..182 978 100 Plus
scaf6-PE 251 CG33522-PE 1..182 1..182 972 98.9 Plus
scaf6-PA 960 CG33522-PA 1..182 1..182 972 98.9 Plus
Sf3a1-PA 784 CG16941-PA 29..84 3..59 150 53.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16600-PA 987 GI16600-PA 1..185 1..182 542 63 Plus
Dmoj\GI23747-PA 788 GI23747-PA 35..84 11..59 155 58 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16064-PA 1001 GL16064-PA 1..192 1..182 606 75 Plus
Dper\GL22993-PA 289 GL22993-PA 35..84 11..59 148 58 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28475-PA 1001 GA28475-PA 1..192 1..182 610 75.5 Plus
Dpse\GA14228-PA 788 GA14228-PA 35..84 11..59 154 58 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24352-PA 210 GM24352-PA 1..49 1..49 269 100 Plus
Dsec\GM15394-PA 784 GM15394-PA 35..84 11..59 154 58 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12428-PA 965 GD12428-PA 1..182 1..182 768 95.6 Plus
Dsim\GD15098-PA 363 GD15098-PA 37..86 11..59 150 58 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12853-PA 992 GJ12853-PA 1..179 1..182 563 62.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20430-PA 1022 GK20430-PA 1..190 1..182 497 61.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22172-PA 960 GE22172-PA 1..180 1..182 712 90.7 Plus
Dyak\GE26116-PA 784 GE26116-PA 35..84 11..59 154 58 Plus