Clone LD14312 Report

Search the DGRC for LD14312

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:143
Well:12
Vector:pBS SK-
Associated Gene/TranscriptCG15107-RA
Protein status:LD14312.pep: gold
Preliminary Size:1206
Sequenced Size:1032

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15107 2002-05-31 Blastp of sequenced clone
CG15107 2003-01-01 Sim4 clustering to Release 3
CG15107 2008-04-29 Release 5.5 accounting
CG15107 2008-08-15 Release 5.9 accounting
CG15107 2008-12-18 5.12 accounting

Clone Sequence Records

LD14312.complete Sequence

1032 bp (1032 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118514

> LD14312.complete
CCAAAATGAATCGACGCAACAAGCGGACGTCGTACTACCAATACGAAGTA
TACCTAGACTTCATGGAGGAGAATCCCCCGATGTCGGCCAACAAACTGAG
TCGCACCCAGGACGGCAAGAAGTGGAAGGAGCTCAGCGATCTGCTAAACA
AGTGCTCCACGGGTCCCACTTTGTCGCCCGAGGAATGGCGAAAGCGCCTC
AACGACTGGAAGAACAGCACGCGCTCCAAATACCGACGCAGCATCAACTC
GGATGACAAGAGCAATGCAATGACTCCTCTGGAGAACAGAGCCCTGCAGA
TCTTCTCCTTAGAACCGAATTTTCGCGAGGGAATTTCGATGCGCCTGCAC
GAACTGATGGAGGAGCAAGAGGAACTGGATGAAGAAGAGAATGAGAACCT
GGAGGAGTTGGTGGATGAGGAGGAGGAGGAGGAGGTGCAGTACCAGCAGT
TCATAGCAGAGCCTCACGAGCAAGCCAACCCAACGATCATCAATGGTCAC
AGTGCCGCGAAAAAGCTAAGGCTCGATGGTTCCAGTGAGATTATCTACGA
AGTCGCGGATGTCACATCTGATCAATCTGCCGCGAAAGAACCGTCTGCCT
TCTATGGAGAGAAAATCCAGGAGCAGCTGAAACGCATTTCGGACATACAC
GAGGCATCGCTGCACTTTAAGATAGCCCGCTTCAAGTACAATAATCCCGG
ATTCGAGTACGTTCCGGAATTATAGCCCATGCTAGCCATGCACATTGATA
TAATGTATAATGTAATATAATATGTGAGCTCAGAGGGACCTGCTGATTTC
GCCTCGAATTAAAAGCCGCGGAACGCTCAATAAGTAGTACAGTAGGCATT
CGTTGAAAACAAATTCTTGAGTAGTGTGTACCATATACCAATTAGTCGTT
TTTAAGACTGTTGTTATGCATATCGTTCGACGAAATACTTTTTGCACATA
TATTTTGAAATGTATTATTGATTTATATGAAACCGCTAATAAATATTGTG
ACAAATCAAAAAAAAAAAAAAAAAAAAAAAAA

LD14312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15107-RA 1181 CG15107-RA 120..1127 1..1008 5040 100 Plus
prod-RA 1614 prod-RA 278..404 116..242 290 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14858418..14858874 1007..551 2285 100 Minus
chr2R 21145070 chr2R 14858938..14859297 552..193 1800 100 Minus
chr2R 21145070 chr2R 14859354..14859547 194..1 970 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18971308..18971765 1008..551 2290 100 Minus
2R 25286936 2R 18971829..18972188 552..193 1800 100 Minus
2R 25286936 2R 18972245..18972438 194..1 970 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18972507..18972964 1008..551 2290 100 Minus
2R 25260384 2R 18973028..18973387 552..193 1800 100 Minus
2R 25260384 2R 18973444..18973637 194..1 970 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:30:06 has no hits.

LD14312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:30:50 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14858418..14858872 553..1007 100 <- Minus
chr2R 14858938..14859295 195..552 90 <- Minus
chr2R 14859354..14859547 1..194 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:41 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..720 6..725 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:30 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..720 6..725 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:53:43 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..720 6..725 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:26:05 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..720 6..725 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:37:30 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..720 6..725 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:43 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:30 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:43 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 100..1106 1..1007 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:26:06 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:30 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
CG15107-RA 100..1106 1..1007 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:50 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18971309..18971763 553..1007 100 <- Minus
2R 18971829..18972186 195..552 100 <- Minus
2R 18972245..18972438 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:50 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18971309..18971763 553..1007 100 <- Minus
2R 18971829..18972186 195..552 100 <- Minus
2R 18972245..18972438 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:50 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18971309..18971763 553..1007 100 <- Minus
2R 18971829..18972186 195..552 100 <- Minus
2R 18972245..18972438 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:43 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14858814..14859268 553..1007 100 <- Minus
arm_2R 14859334..14859691 195..552 100 <- Minus
arm_2R 14859750..14859943 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:31 Download gff for LD14312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18972508..18972962 553..1007 100 <- Minus
2R 18973028..18973385 195..552 100 <- Minus
2R 18973444..18973637 1..194 100   Minus

LD14312.hyp Sequence

Translation from 2 to 724

> LD14312.hyp
KMNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQDGKKWKELSDLLNK
CSTGPTLSPEEWRKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQI
FSLEPNFREGISMRLHELMEEQEELDEEENENLEELVDEEEEEEVQYQQF
IAEPHEQANPTIINGHSAAKKLRLDGSSEIIYEVADVTSDQSAAKEPSAF
YGEKIQEQLKRISDIHEASLHFKIARFKYNNPGFEYVPEL*

LD14312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15107-PA 239 CG15107-PA 1..239 2..240 1246 100 Plus
CG15107-PB 243 CG15107-PB 1..243 2..240 1231 98.4 Plus
prod-PA 346 CG18608-PA 4..343 1..238 419 33.8 Plus

LD14312.pep Sequence

Translation from 5 to 724

> LD14312.pep
MNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQDGKKWKELSDLLNKC
STGPTLSPEEWRKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQIF
SLEPNFREGISMRLHELMEEQEELDEEENENLEELVDEEEEEEVQYQQFI
AEPHEQANPTIINGHSAAKKLRLDGSSEIIYEVADVTSDQSAAKEPSAFY
GEKIQEQLKRISDIHEASLHFKIARFKYNNPGFEYVPEL*

LD14312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13735-PA 232 GF13735-PA 1..232 1..238 532 49.2 Plus
Dana\GF13736-PA 352 GF13736-PA 5..136 1..135 345 53.2 Plus
Dana\GF13736-PA 352 GF13736-PA 214..349 134..237 161 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20930-PA 230 GG20930-PA 1..229 1..238 888 75.2 Plus
Dere\GG20931-PA 346 GG20931-PA 5..136 1..135 337 53.2 Plus
Dere\GG20931-PA 346 GG20931-PA 248..343 161..237 152 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19726-PA 339 GH19726-PA 1..334 1..235 379 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15107-PA 239 CG15107-PA 1..239 1..239 1246 100 Plus
CG15107-PB 243 CG15107-PB 1..243 1..239 1231 98.4 Plus
prod-PA 346 CG18608-PA 5..343 1..237 414 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20147-PA 342 GI20147-PA 1..131 1..135 323 48.2 Plus
Dmoj\GI20147-PA 342 GI20147-PA 225..339 148..237 153 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10575-PA 182 GL10575-PA 1..109 1..105 324 56.9 Plus
Dper\GL10574-PA 152 GL10574-PA 1..74 1..101 185 40.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24412-PA 240 GA24412-PA 1..237 1..237 454 42.7 Plus
Dpse\GA15012-PA 349 GA15012-PA 1..109 1..105 326 56.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19857-PA 240 GM19857-PA 1..240 1..239 1018 86.7 Plus
Dsec\GM19858-PA 342 GM19858-PA 5..113 1..105 336 57.8 Plus
Dsec\GM19858-PA 342 GM19858-PA 210..339 134..237 149 34.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25344-PA 240 GD25344-PA 1..240 1..239 993 85.1 Plus
Dsim\prod-PA 346 GD25345-PA 5..113 1..105 336 57.8 Plus
Dsim\prod-PA 346 GD25345-PA 248..343 161..237 147 38.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22426-PA 343 GJ22426-PA 1..131 1..135 325 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13866-PA 240 GE13866-PA 1..240 1..239 917 78.8 Plus
Dyak\GE13867-PA 346 GE13867-PA 5..136 1..135 337 53.2 Plus