Clone LD14392 Report

Search the DGRC for LD14392

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:143
Well:92
Vector:pBS SK-
Associated Gene/TranscriptCSN5-RA
Protein status:LD14392.pep: gold
Preliminary Size:1189
Sequenced Size:1201

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14884 2001-01-01 Release 2 assignment
CG14884 2002-12-11 Blastp of sequenced clone
CG14884 2003-01-01 Sim4 clustering to Release 3
CSN5 2008-04-29 Release 5.5 accounting
CSN5 2008-08-15 Release 5.9 accounting
CSN5 2008-12-18 5.12 accounting

Clone Sequence Records

LD14392.complete Sequence

1201 bp (1201 high quality bases) assembled on 2002-12-11

GenBank Submission: AF132563

> LD14392.complete
CGGAAAACAAAAACTTGCAACAAAAGACTACAATTTTCGGCATAAGTACA
ATCACAATGGACTCCGACGCCGCACAAAAGACCTGGGAGCTGGAGAACAA
CATCCAGACGTTGCCCAGTTGTGACGAGATCTTTCGCTACGACGCCGAAC
AGCAGCGGCAGATCATCGATGCGAAGCCCTGGGAGAAAGATCCCCACTTC
TTTAAGGACATTAAGATCTCGGCTCTGGCGCTCCTAAAGATGGTGATGCA
CGCTCGCTCTGGCGGTACTTTGGAGGTGATGGGTCTAATGCTTGGCAAGG
TAGAGGACAACACAATGATTGTCATGGATGCATTTGCACTGCCAGTGGAG
GGCACTGAAACCCGCGTCAATGCCCAGGCACAAGCGTACGAGTACATGAC
CGCCTACATGGAAGCGGCCAAAGAGGTGGGACGCATGGAACACGCCGTGG
GCTGGTATCACAGCCATCCCGGTTACGGTTGCTGGTTGTCCGGCATCGAT
GTGTCCACCCAGATGCTCAACCAGACATACCAGGAGCCATTCGTGGCCAT
TGTGGTTGATCCGGTGCGCACTGTTTCCGCTGGCAAGGTGTGTCTGGGTG
CATTCCGCACGTATCCAAAAGGTTATAAGCCACCAAACGAGGAGCCCTCG
GAGTATCAGACCATCCCGCTGAATAAGATCGAAGACTTTGGAGTCCACTG
CAAGCAGTACTATCCCTTGGAAATTAGCTACTTCAAGTCTGCTCTGGACC
GCAGGCTCCTCGACTCTCTGTGGAACAAATACTGGGTAAACACACTGGGC
AGCTCGGGTCTGCTCACCAACACAGAGTACACCACCGGTCAGATCATGGA
TCTCTCCGAGAAGCTGGAGCAGAGTGAGAACTTTTTAGGTCGCGGAACCG
ATGTCAATGAGAAGCGTTCGGAGGATAAGCTGTCCAAGGCCACCCGAGAC
TGCAGCCGCTCCACCATTGAACTGATACACGGCTTGATGGCTCAGATTGT
TAAGGACAAACTTTTCAACAAGGTCGGACTGGGCAAATAGTTCAACACTA
AAATTCGCAATGAATTTTAAAATGCATTGTGAATTTTCTTTTCATTTCCC
TGGGAAATATTTAAGTAAGTCAAGCTTATCCAAAAGAAAAAGGAAATTAT
AAAACCGCCTCATAGGCTGATGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

LD14392.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
CSN5-RA 1398 CSN5-RA 98..1276 1..1179 5895 100 Plus
CSN5.c 1392 CSN5.c 98..1270 1..1179 5780 99.4 Plus
CSN5.a 1370 CSN5.a 44..1158 1..1115 5575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12295179..12295757 317..895 2895 100 Plus
chr3R 27901430 chr3R 12294810..12295126 1..317 1585 100 Plus
chr3R 27901430 chr3R 12295815..12296093 894..1172 1395 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16470492..16471070 317..895 2895 100 Plus
3R 32079331 3R 16470123..16470439 1..317 1585 100 Plus
3R 32079331 3R 16471128..16471413 894..1179 1430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16211323..16211901 317..895 2895 100 Plus
3R 31820162 3R 16210954..16211270 1..317 1585 100 Plus
3R 31820162 3R 16211959..16212244 894..1179 1430 100 Plus
Blast to na_te.dros performed 2019-03-16 00:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1015..1098 1035..1118 122 65.1 Plus

LD14392.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:20:22 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12294810..12295126 1..317 100 -> Plus
chr3R 12295180..12295756 318..894 100 -> Plus
chr3R 12295816..12296093 895..1172 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:45 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 1..984 57..1040 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:58 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 1..984 57..1040 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:48 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 1..984 57..1040 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:54 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 1..984 57..1040 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:02:12 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 1..984 57..1040 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:34 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 23..1194 1..1172 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:58 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 23..1194 1..1172 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:48 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 25..1196 1..1172 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:54 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 23..1194 1..1172 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:02:12 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
CSN5-RA 25..1196 1..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:22 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16470123..16470439 1..317 100 -> Plus
3R 16470493..16471069 318..894 100 -> Plus
3R 16471129..16471406 895..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:22 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16470123..16470439 1..317 100 -> Plus
3R 16470493..16471069 318..894 100 -> Plus
3R 16471129..16471406 895..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:22 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16470123..16470439 1..317 100 -> Plus
3R 16470493..16471069 318..894 100 -> Plus
3R 16471129..16471406 895..1172 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:48 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12295845..12296161 1..317 100 -> Plus
arm_3R 12296215..12296791 318..894 100 -> Plus
arm_3R 12296851..12297128 895..1172 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:46 Download gff for LD14392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16210954..16211270 1..317 100 -> Plus
3R 16211324..16211900 318..894 100 -> Plus
3R 16211960..16212237 895..1172 100   Plus

LD14392.hyp Sequence

Translation from 2 to 1039

> LD14392.hyp
ENKNLQQKTTIFGISTITMDSDAAQKTWELENNIQTLPSCDEIFRYDAEQ
QRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKV
EDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVG
WYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGA
FRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDR
RLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTD
VNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKVGLGK*

LD14392.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
CSN5-PA 327 CG14884-PA 1..327 19..345 1725 100 Plus
CSN5-PB 325 CG14884-PB 1..325 19..345 1701 99.4 Plus
Rpn11-PA 308 CG18174-PA 27..256 68..291 376 38 Plus

LD14392.pep Sequence

Translation from 56 to 1039

> LD14392.pep
MDSDAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFK
DIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGT
ETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVS
TQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEY
QTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKYWVNTLGSS
GLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCS
RSTIELIHGLMAQIVKDKLFNKVGLGK*

LD14392.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18500-PA 320 GF18500-PA 1..320 1..327 1709 96.6 Plus
Dana\GF14156-PA 308 GF14156-PA 29..269 52..293 379 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17007-PA 327 GG17007-PA 1..327 1..327 1774 99.7 Plus
Dere\GG24318-PA 308 GG24318-PA 29..256 52..273 378 38.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19288-PA 327 GH19288-PA 1..327 1..327 1750 98.2 Plus
Dgri\GH10267-PA 308 GH10267-PA 29..256 52..273 376 37.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
CSN5-PA 327 CG14884-PA 1..327 1..327 1725 100 Plus
CSN5-PB 325 CG14884-PB 1..325 1..327 1701 99.4 Plus
Rpn11-PA 308 CG18174-PA 27..256 50..273 376 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23503-PA 327 GI23503-PA 1..327 1..327 1747 97.9 Plus
Dmoj\GI15638-PA 308 GI15638-PA 29..256 52..273 376 37.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22178-PA 327 GL22178-PA 1..327 1..327 1763 99.1 Plus
Dper\GL26475-PA 308 GL26475-PA 29..256 52..273 381 38.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13321-PA 327 GA13321-PA 1..327 1..327 1763 99.1 Plus
Dpse\GA14824-PA 308 GA14824-PA 29..256 52..273 378 38.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15160-PA 327 GM15160-PA 1..327 1..327 1778 100 Plus
Dsec\GM18036-PA 308 GM18036-PA 29..256 52..273 378 38.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19103-PA 321 GD19103-PA 1..321 1..327 1728 98.2 Plus
Dsim\GD22663-PA 308 GD22663-PA 29..256 52..273 378 38.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10255-PA 327 GJ10255-PA 1..327 1..327 1743 97.6 Plus
Dvir\GJ10111-PA 308 GJ10111-PA 29..256 52..273 376 37.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14483-PA 327 GK14483-PA 1..327 1..327 1768 99.4 Plus
Dwil\GK19363-PA 111 GK19363-PA 1..106 213..320 530 93.5 Plus
Dwil\GK24437-PA 322 GK24437-PA 8..115 39..177 425 64 Plus
Dwil\GK23790-PA 308 GK23790-PA 29..256 52..273 378 38.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\CSN5-PA 327 GE24400-PA 1..327 1..327 1774 99.7 Plus
Dyak\Rpn11-PA 308 GE18698-PA 29..256 52..273 378 38.4 Plus