Clone LD14730 Report

Search the DGRC for LD14730

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:147
Well:30
Vector:pBS SK-
Associated Gene/TranscriptCG31673-RA
Protein status:LD14730.pep: gold
Preliminary Size:1370
Sequenced Size:1123

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9332 2001-01-01 Release 2 assignment
CG31673 2002-06-06 Blastp of sequenced clone
CG31673 2003-01-01 Sim4 clustering to Release 3
CG31673 2008-04-29 Release 5.5 accounting
CG31673 2008-08-15 Release 5.9 accounting
CG31673 2008-12-18 5.12 accounting

Clone Sequence Records

LD14730.complete Sequence

1123 bp (1123 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119585

> LD14730.complete
ATTCGCCGCTACTAGTTGATATTAAGTGCTATATTTTCCCCCGAAATGTC
TCGTGCGACCAGGGCTTTTAAAGTGCTGATTTCGCATCCAAATGTCCCAG
CACCGGCTCTGGAACTGCTCCGATCCCGTGGAGCGGAGACCATCATCTGC
CAGAGTGTGCCGCCCTCGAGGGATGAGATCCTGCAGAAGGTGCCCGGCGT
GGATGCCATCTATTGGGCCCATTACCAGCCCCTGAATGCCGGAATCCTGG
ATGCTGCTGGATCCCAGCTGCGTTGCGTGAGCACCATGTCCTCCGGAATC
GATTTTGTGGATATTCCGGAGTTCCAGAAGAGGGGAATCCCATTGGGCCA
CACTCCCGGGGTGGTGAAAAATGCAGTGGCCGATCTCGCCATTGGCTTGA
TGATTGCAGCCGGTCGTCACTTTCATGCCGGTCGCACCGAAATCGAGAGG
TCCCAATGGAAAATCGAGCAGATCAACTGGATGATGGGTCAAGAGATTCG
CGATTCCGTCATCGGTTTCTTTGGCTTTGGCGGTATTAGTCAGGCCATCG
CCAAGCGATTGCAGTGCTGGGATGTGGCCAAGATCATCTACCATACTCGC
ACCCGAAAGGAAAACGATGGCGACTTCAAGGCAGAGCATGTGTCGTTTGA
ACAACTTTTACAAGAAAGTGACTTCCTGGTGGTAGCTGCTCCACTTACAA
ACGAAACTAGAGAGAAATTCAATGGAAAGGCATTTAATCTGATGAAGAGG
AGTTCTGTGTTTGTCAATGTGGCCAGAGGAGGTCTGGTAAATCAAACTGA
CCTTCATGACGCCCTGACAAATGGTACAATTTCTGCCGCAGGCTTGGATG
TGACCACACCAGAACCACTGCCCGCCAATAGTCCTCTTCTCAATGTGCCC
AATTGTGTTATCCTTCCCCATATGGGCACTCAGACAATGAAGACTACCAT
TGAAATGGGATTGCTTGCTGCCAATAATATTTTGAACGCCATCGAAGGGA
AGCCCATGATAAGGCCAGCCTACTGAGAACATGCAAAATTTGAATGGAAG
AAACTTTACCTGTATCCTACTCGGATCGGAAAATCAATATTAAAAAATGA
TATTAAACATAAAAAAAAAAAAA

LD14730.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31673-RA 1383 CG31673-RA 160..1274 1..1115 5560 99.9 Plus
CG31673.a 1192 CG31673.a 18..1129 1..1115 5490 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20828131..20828581 1..451 2240 99.8 Plus
chr2L 23010047 chr2L 20828785..20829120 448..783 1665 99.7 Plus
chr2L 23010047 chr2L 20829366..20829569 907..1110 1020 100 Plus
chr2L 23010047 chr2L 20829175..20829302 780..907 640 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20829625..20830075 1..451 2255 100 Plus
2L 23513712 2L 20830279..20830614 448..783 1680 100 Plus
2L 23513712 2L 20830860..20831068 907..1115 1030 99.5 Plus
2L 23513712 2L 20830669..20830796 780..907 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20829625..20830075 1..451 2255 100 Plus
2L 23513712 2L 20830279..20830614 448..783 1680 100 Plus
2L 23513712 2L 20830860..20831068 907..1115 1030 99.5 Plus
2L 23513712 2L 20830669..20830796 780..907 640 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:03:42 has no hits.

LD14730.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:04:53 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20828787..20829118 450..781 99 -> Plus
chr2L 20829177..20829302 782..907 100 -> Plus
chr2L 20829367..20829569 908..1110 100   Plus
chr2L 20828131..20828579 1..449 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:03 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 1..981 46..1026 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:02 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 1..981 46..1026 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:41 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 1..981 46..1026 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:07 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 1..981 46..1026 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:35 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 1..981 46..1026 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:00:57 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 18..1127 1..1110 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:01 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 18..1127 1..1110 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:41 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 17..1126 1..1110 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:07 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 18..1127 1..1110 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:35 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
CG31673-RA 17..1126 1..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:04:53 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20829625..20830073 1..449 100 -> Plus
2L 20830281..20830612 450..781 100 -> Plus
2L 20830671..20830796 782..907 100 -> Plus
2L 20830861..20831063 908..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:04:53 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20829625..20830073 1..449 100 -> Plus
2L 20830281..20830612 450..781 100 -> Plus
2L 20830671..20830796 782..907 100 -> Plus
2L 20830861..20831063 908..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:04:53 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20829625..20830073 1..449 100 -> Plus
2L 20830281..20830612 450..781 100 -> Plus
2L 20830671..20830796 782..907 100 -> Plus
2L 20830861..20831063 908..1110 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:41 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20830861..20831063 908..1110 100   Plus
arm_2L 20830281..20830612 450..781 100 -> Plus
arm_2L 20830671..20830796 782..907 100 -> Plus
arm_2L 20829625..20830073 1..449 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:54:56 Download gff for LD14730.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20829625..20830073 1..449 100 -> Plus
2L 20830281..20830612 450..781 100 -> Plus
2L 20830671..20830796 782..907 100 -> Plus
2L 20830861..20831063 908..1110 100   Plus

LD14730.pep Sequence

Translation from 45 to 1025

> LD14730.pep
MSRATRAFKVLISHPNVPAPALELLRSRGAETIICQSVPPSRDEILQKVP
GVDAIYWAHYQPLNAGILDAAGSQLRCVSTMSSGIDFVDIPEFQKRGIPL
GHTPGVVKNAVADLAIGLMIAAGRHFHAGRTEIERSQWKIEQINWMMGQE
IRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDGDFKAEHVS
FEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLVNQ
TDLHDALTNGTISAAGLDVTTPEPLPANSPLLNVPNCVILPHMGTQTMKT
TIEMGLLAANNILNAIEGKPMIRPAY*

LD14730.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20919-PA 324 GF20919-PA 1..324 1..326 1562 88.3 Plus
Dana\GF20908-PA 361 GF20908-PA 40..361 6..326 941 53.3 Plus
Dana\GF20930-PA 327 GF20930-PA 5..327 6..326 869 51.4 Plus
Dana\GF16345-PA 325 GF16345-PA 7..319 10..321 586 42.5 Plus
Dana\GF15130-PA 332 GF15130-PA 14..307 17..313 241 23.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21257-PA 326 GG21257-PA 1..326 1..326 1683 95.4 Plus
Dere\GG21256-PA 364 GG21256-PA 41..364 4..326 946 52.6 Plus
Dere\GG21258-PA 327 GG21258-PA 3..327 4..326 867 49.8 Plus
Dere\GG13007-PA 325 GG13007-PA 6..319 9..321 585 42.7 Plus
Dere\GG10320-PA 332 GG10320-PA 7..307 9..313 246 23.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10588-PA 325 GH10588-PA 4..325 5..326 1446 82.3 Plus
Dgri\GH10587-PA 356 GH10587-PA 33..356 4..326 934 53.2 Plus
Dgri\GH18259-PA 324 GH18259-PA 6..319 9..321 627 44.9 Plus
Dgri\GH13534-PA 332 GH13534-PA 14..315 17..319 260 25.4 Plus
Dgri\CtBP-PA 492 GH18368-PA 58..341 41..318 194 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG31673-PA 326 CG31673-PA 1..326 1..326 1686 100 Plus
CG31673-PB 325 CG31673-PB 1..325 1..326 1660 99.4 Plus
CG9331-PK 326 CG9331-PK 3..326 4..326 912 52.9 Plus
CG9331-PJ 326 CG9331-PJ 3..326 4..326 912 52.9 Plus
CG9331-PG 326 CG9331-PG 3..326 4..326 912 52.9 Plus
CG9331-PF 326 CG9331-PF 3..326 4..326 912 52.9 Plus
CG9331-PB 326 CG9331-PB 3..326 4..326 912 52.9 Plus
CG9331-PD 326 CG9331-PD 3..326 4..326 912 52.9 Plus
CG9331-PL 364 CG9331-PL 41..364 4..326 912 52.9 Plus
CG9331-PI 364 CG9331-PI 41..364 4..326 912 52.9 Plus
CG9331-PH 364 CG9331-PH 41..364 4..326 912 52.9 Plus
CG9331-PM 364 CG9331-PM 41..364 4..326 912 52.9 Plus
CG9331-PA 364 CG9331-PA 41..364 4..326 912 52.9 Plus
CG9331-PC 364 CG9331-PC 41..364 4..326 912 52.9 Plus
CG31674-PB 327 CG31674-PB 4..327 5..326 852 50.9 Plus
CG31674-PA 327 CG31674-PA 4..327 5..326 852 50.9 Plus
CG1236-PA 347 CG1236-PA 22..342 3..322 632 41.7 Plus
CG6287-PA 332 CG6287-PA 7..307 9..313 251 23.8 Plus
CtBP-PI 379 CG7583-PI 58..338 41..318 195 28.8 Plus
CtBP-PF 383 CG7583-PF 58..338 41..318 195 28.8 Plus
CtBP-PG 473 CG7583-PG 58..338 41..318 195 28.8 Plus
CtBP-PJ 476 CG7583-PJ 58..338 41..318 195 28.8 Plus
CtBP-PH 481 CG7583-PH 58..338 41..318 195 28.8 Plus
CtBP-PA 386 CG7583-PA 58..341 41..318 188 28.3 Plus
CtBP-PB 386 CG7583-PB 58..341 41..318 188 28.3 Plus
CtBP-PD 386 CG7583-PD 58..341 41..318 188 28.3 Plus
CtBP-PC 386 CG7583-PC 58..341 41..318 188 28.3 Plus
CtBP-PE 476 CG7583-PE 58..341 41..318 188 28.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23165-PA 401 GI23165-PA 36..401 4..326 1021 52.9 Plus
Dmoj\GI23143-PA 357 GI23143-PA 33..357 2..326 765 45.3 Plus
Dmoj\GI23154-PA 352 GI23154-PA 32..352 2..326 684 40.7 Plus
Dmoj\GI23658-PA 324 GI23658-PA 7..319 10..321 593 43.8 Plus
Dmoj\GI18148-PA 332 GI18148-PA 38..307 43..313 250 24.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18524-PA 330 GL18524-PA 11..330 7..326 1502 85.9 Plus
Dper\GL18523-PA 362 GL18523-PA 41..362 6..326 949 53.9 Plus
Dper\GL24519-PA 304 GL24519-PA 6..298 9..321 517 40.4 Plus
Dper\GL18582-PA 332 GL18582-PA 19..307 22..313 258 24.5 Plus
Dper\CtBP-PA 482 GL24381-PA 58..341 41..318 195 28.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16384-PA 330 GA16384-PA 11..330 7..326 1500 85.6 Plus
Dpse\GA21708-PA 362 GA21708-PA 41..362 6..326 948 53.9 Plus
Dpse\GA11580-PA 325 GA11580-PA 6..319 9..321 591 43.3 Plus
Dpse\GA19489-PA 332 GA19489-PA 19..307 22..313 258 24.5 Plus
Dpse\GA20456-PD 383 GA20456-PD 58..338 41..318 202 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23374-PA 364 GM23374-PA 41..364 4..326 949 52.9 Plus
Dsec\GM23375-PA 180 GM23375-PA 1..180 147..326 932 96.7 Plus
Dsec\GM23376-PA 327 GM23376-PA 4..327 5..326 874 50 Plus
Dsec\GM10835-PA 325 GM10835-PA 6..319 9..321 575 42.4 Plus
Dsec\GM11122-PA 332 GM11122-PA 7..307 9..313 249 23.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24284-PA 326 GD24284-PA 1..326 1..326 1714 97.9 Plus
Dsim\GD24283-PA 364 GD24283-PA 41..364 4..326 952 53.5 Plus
Dsim\GD24286-PA 327 GD24286-PA 4..327 5..326 871 50 Plus
Dsim\GD19816-PA 307 GD19816-PA 15..301 36..321 541 43.2 Plus
Dsim\GD22186-PA 332 GD22186-PA 7..307 9..313 248 23.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23664-PA 325 GJ23664-PA 5..325 6..326 1376 81.9 Plus
Dvir\GJ23653-PA 359 GJ23653-PA 36..359 4..326 878 52.6 Plus
Dvir\GJ23501-PA 324 GJ23501-PA 7..319 10..321 662 44.1 Plus
Dvir\GJ14930-PA 332 GJ14930-PA 14..307 17..313 247 24.4 Plus
Dvir\CtBP-PA 502 GJ10351-PA 58..341 41..318 195 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15436-PA 326 GK15436-PA 1..326 1..326 1503 84.4 Plus
Dwil\GK15435-PA 326 GK15435-PA 5..326 6..326 918 51.7 Plus
Dwil\GK15437-PA 329 GK15437-PA 1..329 1..326 865 51.7 Plus
Dwil\GK13923-PA 324 GK13923-PA 6..318 10..321 689 44.1 Plus
Dwil\GK15239-PA 332 GK15239-PA 19..307 22..313 263 24.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12351-PA 326 GE12351-PA 1..326 1..326 1662 94.8 Plus
Dyak\GE12350-PA 364 GE12350-PA 41..364 4..326 962 53.5 Plus
Dyak\GE12352-PA 327 GE12352-PA 3..327 4..326 867 49.5 Plus
Dyak\GE10159-PA 325 GE10159-PA 6..319 9..321 595 43.6 Plus
Dyak\GE12961-PA 332 GE12961-PA 7..307 9..313 248 23.8 Plus

LD14730.hyp Sequence

Translation from 45 to 1025

> LD14730.hyp
MSRATRAFKVLISHPNVPAPALELLRSRGAETIICQSVPPSRDEILQKVP
GVDAIYWAHYQPLNAGILDAAGSQLRCVSTMSSGIDFVDIPEFQKRGIPL
GHTPGVVKNAVADLAIGLMIAAGRHFHAGRTEIERSQWKIEQINWMMGQE
IRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDGDFKAEHVS
FEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLVNQ
TDLHDALTNGTISAAGLDVTTPEPLPANSPLLNVPNCVILPHMGTQTMKT
TIEMGLLAANNILNAIEGKPMIRPAY*

LD14730.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31673-PA 326 CG31673-PA 1..326 1..326 1686 100 Plus
CG31673-PB 325 CG31673-PB 1..325 1..326 1660 99.4 Plus
CG9331-PK 326 CG9331-PK 3..326 4..326 912 52.9 Plus
CG9331-PJ 326 CG9331-PJ 3..326 4..326 912 52.9 Plus
CG9331-PG 326 CG9331-PG 3..326 4..326 912 52.9 Plus