Clone LD14731 Report

Search the DGRC for LD14731

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:147
Well:31
Vector:pBS SK-
Associated Gene/TranscriptCoVIIc-RA
Protein status:LD14731.pep: gold
Preliminary Size:1386
Sequenced Size:1186

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2249 2002-05-30 Blastp of sequenced clone
CG2249 2003-01-01 Sim4 clustering to Release 3
CG2249 2008-04-29 Release 5.5 accounting
CG2249 2008-08-15 Release 5.9 accounting
CG2249 2008-12-18 5.12 accounting

Clone Sequence Records

LD14731.complete Sequence

1186 bp (1186 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118515

> LD14731.complete
CCACTGCGAACTTTATTTTCCTGGAATTATTATCAAATAAGTCAAATTGC
GAGATGTTGGGCCGCAGCAGTGTGATTGCACGCAACTTTTCCCAGTCGAT
GGTTCGCTTTAGCGGACATGGTGGAGTTCCCGGAGAGAATCTTCCCTTCG
GGCTGACGAACAAGTACCGCATCACCGCCCTGTTCACCATCGGCTGTGTC
TTGGGCTTCGGATCGCCCTTCCTGATCGTCAGGCACCAACTGCTCAAGAA
GTAAGGGGCTCCCCTGGCGACAGCAACAACAAATGTAAGATGTAGCGTTA
TCTGCTGAGTTGGCCGGCAGGCCATTACAGTGTGTTACAGCTTAAATTTA
AGTAAAAAGTGGAAACGAAATAAAGTTACCCGTGACCGTAGAACCGATTG
GTGGATGTTTTCTTTAAAAGCTGGCAAGACGGCTTATGTGGAACAACAGT
TTGTTTGGTATTGGCACTTGTAAATGCATCCACGCTTATTTTTAAAGCTT
TTAGTATCAATATCTTGTGGCTAAACTATGGAAACTGTGCTCGCAAATAA
CATGGACTTGGTAGAACGACGTCAGAAACCGATGTACACGCAAAGTTGCC
AACTGGAAGGAATATTTCTAGTAATGGTGAAGTTTTAAGGGTTCCCTTAA
GTAGGCTTGCCTATAAAGATATATGTCAGGAAATTTTTCGAAAAGCCAGT
AACTTTCATTCGTTCGCTAGAAATCTGGGAGTAACTTCTCACTCGCAAGC
AATCAAATAATTTCTTATTCCCGTCTCAACAAACGGATTAAAATTTACTC
ATGTGGCCCACACTTCGTAAACCCATTGGCAAGTTTAGCGGGCCGCTGAT
GCGTTATGGGAGTGGATATCCAGGCGGCTCTCCTGGGGCGGTAGTTAATC
CAAGGTCAACACGCAGCTAACCATTCTAAGAACTTACAATTTCCCTCACA
GAACTTACCCTTTGGCTTGGATAGTCCAATGCGTTTCACACTATTTTACC
TAATTGCGGGAGTCGTGGGCTTTGGGGCTCCGTTCCTAGTTATTCGCCAT
CAGATGCTTCGTAATGTAACCAATGATCCCAAGGATGAGTAATCCCAAAA
TGACATAGAACACTCGTTAATAAATTAATAAAAATACATTGCACATGGAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD14731.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG2249-RA 1346 CG2249-RA 164..1313 1..1150 5750 100 Plus
CG2249.a 1007 CG2249.a 164..1007 1..844 4220 100 Plus
CG2249-RB 799 CG2249-RB 164..799 1..636 3180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5937496..5938287 288..1079 3960 100 Plus
chr2R 21145070 chr2R 5937289..5937442 136..289 770 100 Plus
chr2R 21145070 chr2R 5937047..5937182 1..137 635 99.3 Plus
chr2R 21145070 chr2R 5938344..5938412 1080..1148 345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10049958..10050749 288..1079 3960 100 Plus
2R 25286936 2R 10049751..10049904 136..289 770 100 Plus
2R 25286936 2R 10049508..10049644 1..137 685 100 Plus
2R 25286936 2R 10050806..10050876 1080..1150 355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10051157..10051948 288..1079 3960 100 Plus
2R 25260384 2R 10050950..10051103 136..289 770 100 Plus
2R 25260384 2R 10050707..10050843 1..137 685 100 Plus
2R 25260384 2R 10052005..10052075 1080..1150 355 100 Plus
Blast to na_te.dros performed 2019-03-16 16:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
diver2 4917 diver2 DIVER2 4917bp 440..467 1113..1140 113 89.3 Plus

LD14731.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:04:56 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5937047..5937182 1..137 99 -> Plus
chr2R 5937291..5937442 138..289 100 -> Plus
chr2R 5937498..5938287 290..1079 100 -> Plus
chr2R 5938344..5938412 1080..1148 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:04 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CG2249-RB 1..201 54..254 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:36:27 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CG2249-RB 1..201 54..254 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:51 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIIc-RB 1..201 54..254 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:03 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CG2249-RB 1..201 54..254 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:45 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIIc-RB 1..201 54..254 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:08:28 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CG2249-RA 26..1173 1..1148 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:36:27 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CG2249-RA 29..1176 1..1148 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:51 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIIc-RA 28..423 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:03 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CG2249-RA 26..1173 1..1148 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:45 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIIc-RA 28..423 1..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:04:56 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10049508..10049644 1..137 100 -> Plus
2R 10049753..10049904 138..289 100 -> Plus
2R 10049960..10050749 290..1079 100 -> Plus
2R 10050806..10050874 1080..1148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:04:56 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10049508..10049644 1..137 100 -> Plus
2R 10049753..10049904 138..289 100 -> Plus
2R 10049960..10050749 290..1079 100 -> Plus
2R 10050806..10050874 1080..1148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:04:56 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10049508..10049644 1..137 100 -> Plus
2R 10049753..10049904 138..289 100 -> Plus
2R 10049960..10050749 290..1079 100 -> Plus
2R 10050806..10050874 1080..1148 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:51 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5937013..5937149 1..137 100 -> Plus
arm_2R 5937258..5937409 138..289 100 -> Plus
arm_2R 5937465..5938254 290..1079 100 -> Plus
arm_2R 5938311..5938379 1080..1148 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:00:34 Download gff for LD14731.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10051159..10051948 290..1079 100 -> Plus
2R 10052005..10052073 1080..1148 100   Plus
2R 10050707..10050843 1..137 100 -> Plus
2R 10050952..10051103 138..289 100 -> Plus

LD14731.hyp Sequence

Translation from 2 to 253

> LD14731.hyp
TANFIFLELLSNKSNCEMLGRSSVIARNFSQSMVRFSGHGGVPGENLPFG
LTNKYRITALFTIGCVLGFGSPFLIVRHQLLKK*

LD14731.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIIc-PD 66 CG2249-PD 1..66 18..83 341 100 Plus
CoVIIc-PC 66 CG2249-PC 1..66 18..83 341 100 Plus
CoVIIc-PB 66 CG2249-PB 1..66 18..83 341 100 Plus
CoVIIc-PA 66 CG2249-PA 1..66 18..83 341 100 Plus
CG44296-PA 76 CG44296-PA 12..67 29..82 144 51.8 Plus

LD14731.pep Sequence

Translation from 53 to 253

> LD14731.pep
MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVL
GFGSPFLIVRHQLLKK*

LD14731.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12011-PA 66 GF12011-PA 1..66 1..66 326 97 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24130-PA 66 GG24130-PA 1..66 1..66 328 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21643-PA 66 GH21643-PA 1..66 1..66 319 92.4 Plus
Dgri\GH21644-PA 67 GH21644-PA 8..58 18..65 127 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
COX7C-PD 66 CG2249-PD 1..66 1..66 341 100 Plus
COX7C-PC 66 CG2249-PC 1..66 1..66 341 100 Plus
COX7C-PB 66 CG2249-PB 1..66 1..66 341 100 Plus
COX7C-PA 66 CG2249-PA 1..66 1..66 341 100 Plus
CG44296-PA 76 CG44296-PA 12..67 12..65 144 51.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20097-PA 66 GI20097-PA 1..66 1..66 313 89.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11513-PA 66 GL11513-PA 1..66 1..66 336 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15322-PA 66 GA15322-PA 1..66 1..66 336 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18734-PA 66 GM18734-PA 1..66 1..66 336 100 Plus
Dsec\GM21177-PA 66 GM21177-PA 1..66 1..66 336 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoVIIc-PA 71 GD10709-PA 1..66 1..66 336 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19864-PA 66 GJ19864-PA 1..66 1..66 327 97 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21957-PA 66 GK21957-PA 1..66 1..66 323 93.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19330-PA 66 GE19330-PA 1..66 1..66 336 100 Plus
Dyak\GE19331-PA 76 GE19331-PA 25..68 23..66 129 50 Plus