Clone LD14783 Report

Search the DGRC for LD14783

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:147
Well:83
Vector:pBS SK-
Associated Gene/TranscriptCG7341-RA
Protein status:LD14783.pep: gold
Preliminary Size:1524
Sequenced Size:1409

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7341 2001-01-01 Release 2 assignment
CG7341 2001-11-29 Blastp of sequenced clone
CG7341 2008-04-29 Release 5.5 accounting
CG7341 2008-08-15 Release 5.9 accounting
CG32195 2008-08-15 Release 5.9 accounting
CG7341 2008-12-18 5.12 accounting
CG32195 2008-12-18 5.12 accounting

Clone Sequence Records

LD14783.complete Sequence

1409 bp (1409 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069437

> LD14783.complete
CTTAATTTTGTAAATATTTAGATGTTTTTCAGCATTTACATTTTAAACCC
GTGCTTATTGTGTATAAAATAATGTATTCTGATTAAAAGTTCAACGTGCA
CTTATGGTGCTTACTGCAATAAGCGTGATTCAATGCAAATGCTTATATTT
GTTGATTTAATAAACATTCGCAAAGTGTATTTTTGAATTGCCTTCAGCAA
AATGCGACCCAAGGATCACCCTGATCTGCACTTCGACGTGATTCCCAAGC
TCTACGATGCCCATTCCAAGGTGTTTCTAACCAGCTTGTGCGATGTGGAT
GAGCAGCTGAAACTATTGCCACGCCGATTCTGTCGGATGTACACCACTCG
GCCACTGGCCACCCAGCTGTTTCAGTATCTGCAATCCCGCAAAGCGAACG
TTTCGGAACAGGACTTCCTTGTGGTGGAGGAGGGCCAGCCCTTCGCACTG
CTTCTGAAAGACGGAAAACGGTTGGAAGGGATGCTATGCTCTGGAAGTCA
TCTGGGACACAGCCTCATTCTGCTTATCCGGCGGCAGCAGGGTAACAGAT
TGCTGTACTGCTACTCGGCTATGAGGCTGGATAATCTTGGTCGTCTACTG
GGCAACTCTGTCTTCAACTCTTGGATCGCCCAGGGAACCGAGCAGCTGTA
TCTGAATCTGTCCTCTGTAAATTTGCCGTTTGATCATATTGATTTTGATG
AGATGGCACATTTCATCGAGGATCTCGGAGCAAGAAATGACCAGAGTATG
GTGCACCTGAAAGTGCCAAAATTTGGCTACGAGGAAATGTTATGGAGATT
GGCACACACAAGTCTTCGCGGGCATATTCATTTGGGCGACCACATTGCAA
AAAGCTATGAGTGCCTTAGCATCGATCTGGAGCGTTTTCTGGAGGAAAAT
TATGTACCAAGGGTTTTCGTCAGCGGTTGCCCGACGGACTTTAATCACTA
TCAAAAGGTAGTTTCCTTGGATCTAAAGGAACTAAAGTGGACACCGACTC
CGACCAGGATGCATCTTCGGCAGCTATGCAGCCTCTTGCGACCTCAACAC
ATCCAGGGGATTGTTCAGTTTCATACGGATGGCATTGTGCCTCCCATTCC
GTCATTCCTAAAGATCTTCAAGGCAAACTATTCACCGCAGAGTGGTGCAG
TGGTCTCAAGGATTAGGAGTGAATTTCAAGCAGGACAGCCGAAGCAAGGA
CCCTATCACGCTTTCCGGTCCAGAAGGGCCTTTGAATTTGTGAACGATGG
CGACGAAAGCAGTAGTTCGAATTAGGTTAAAGTATCTCCCTATTAGAATA
AGCAAGTCGTGTAGCTGTTGTTCCGCACAGTGCCCCTAGGAGTTTTATTT
ATCCAAACGCTTCACAATATATAAAAATAAATTATTTGAAAAAAAAAAAA
AAAAAAAAA

LD14783.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7341-RA 1434 CG7341-RA 43..1432 1..1390 6950 100 Plus
CG7341-RB 1453 CG7341-RB 235..1451 174..1390 6085 100 Plus
CG32195-RA 1690 CG32195-RA 38..214 1..177 885 100 Plus
CG7341-RB 1453 CG7341-RB 43..218 1..176 880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18109470..18110684 174..1388 6045 99.8 Plus
chr3L 24539361 chr3L 18102692..18102866 1..175 875 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:02:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18119789..18121005 174..1390 6085 100 Plus
3L 28110227 3L 18113007..18113181 1..175 875 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18112889..18114105 174..1390 6085 100 Plus
3L 28103327 3L 18106107..18106281 1..175 875 100 Plus
Blast to na_te.dros performed 2019-03-15 18:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dhyd\Minos 1773 Dhyd\Minos DHMINOS 1773bp Derived from Z29098. 1092..1127 39..5 114 83.3 Minus

LD14783.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:24:18 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18102692..18102866 1..175 100 -> Plus
chr3L 18109472..18110684 176..1388 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:09 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RB 1..1074 202..1275 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:23:06 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RB 1..1074 202..1275 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:28 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 1..1074 202..1275 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:49:42 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RB 1..1074 202..1275 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:46 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 1..1074 202..1275 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:58:03 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 43..1430 1..1388 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:23:06 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 43..1430 1..1388 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:28 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 49..1436 1..1388 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:49:42 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 43..1430 1..1388 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:46 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RA 49..1436 1..1388 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:24:18 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18113007..18113181 1..175 100 -> Plus
3L 18119791..18121003 176..1388 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:24:18 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18113007..18113181 1..175 100 -> Plus
3L 18119791..18121003 176..1388 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:24:18 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18113007..18113181 1..175 100 -> Plus
3L 18119791..18121003 176..1388 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:28 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18106107..18106281 1..175 100 -> Plus
arm_3L 18112891..18114103 176..1388 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:26:08 Download gff for LD14783.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18112891..18114103 176..1388 100   Plus
3L 18106107..18106281 1..175 100 -> Plus

LD14783.pep Sequence

Translation from 201 to 1274

> LD14783.pep
MRPKDHPDLHFDVIPKLYDAHSKVFLTSLCDVDEQLKLLPRRFCRMYTTR
PLATQLFQYLQSRKANVSEQDFLVVEEGQPFALLLKDGKRLEGMLCSGSH
LGHSLILLIRRQQGNRLLYCYSAMRLDNLGRLLGNSVFNSWIAQGTEQLY
LNLSSVNLPFDHIDFDEMAHFIEDLGARNDQSMVHLKVPKFGYEEMLWRL
AHTSLRGHIHLGDHIAKSYECLSIDLERFLEENYVPRVFVSGCPTDFNHY
QKVVSLDLKELKWTPTPTRMHLRQLCSLLRPQHIQGIVQFHTDGIVPPIP
SFLKIFKANYSPQSGAVVSRIRSEFQAGQPKQGPYHAFRSRRAFEFVNDG
DESSSSN*

LD14783.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23618-PA 359 GF23618-PA 1..358 1..353 939 53.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13651-PA 357 GG13651-PA 1..356 1..356 1652 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14451-PA 365 GH14451-PA 1..304 1..314 794 50.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7341-PB 357 CG7341-PB 1..357 1..357 1893 100 Plus
CG7341-PA 357 CG7341-PA 1..357 1..357 1893 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13587-PA 370 GI13587-PA 1..330 1..334 802 48.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22866-PA 403 GL22866-PA 144..352 107..313 520 51 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20277-PA 363 GA20277-PA 1..357 1..354 930 52.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14966-PA 357 GM14966-PA 1..356 1..356 1824 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14746-PA 357 GD14746-PA 1..356 1..356 1834 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13924-PA 377 GJ13924-PA 1..313 1..314 796 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24761-PA 349 GK24761-PA 1..349 1..354 818 47 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19948-PA 357 GE19948-PA 1..356 1..356 1641 85.7 Plus

LD14783.hyp Sequence

Translation from 201 to 1274

> LD14783.hyp
MRPKDHPDLHFDVIPKLYDAHSKVFLTSLCDVDEQLKLLPRRFCRMYTTR
PLATQLFQYLQSRKANVSEQDFLVVEEGQPFALLLKDGKRLEGMLCSGSH
LGHSLILLIRRQQGNRLLYCYSAMRLDNLGRLLGNSVFNSWIAQGTEQLY
LNLSSVNLPFDHIDFDEMAHFIEDLGARNDQSMVHLKVPKFGYEEMLWRL
AHTSLRGHIHLGDHIAKSYECLSIDLERFLEENYVPRVFVSGCPTDFNHY
QKVVSLDLKELKWTPTPTRMHLRQLCSLLRPQHIQGIVQFHTDGIVPPIP
SFLKIFKANYSPQSGAVVSRIRSEFQAGQPKQGPYHAFRSRRAFEFVNDG
DESSSSN*

LD14783.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7341-PB 357 CG7341-PB 1..357 1..357 1893 100 Plus
CG7341-PA 357 CG7341-PA 1..357 1..357 1893 100 Plus