LD15002.complete Sequence
1303 bp (1303 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061185
> LD15002.complete
CAAACTAGGCCATTTTACTCAATCTACACATAAACATTGACTGTACAACA
TGCTCAAGCTTTCGCTGTGACTCAAAAACACTCCAAAACTCGGATTTGCA
TCAGTCTTCCTACAAAGGCGTTAAGGGGAATGTTGTACACCGGACAAAAA
GAATGGTTATACTATTAACTATATGCTGTCGTGTTGAGGCACAAGAGTAG
TGTAACATTAAAAGTGTGTCGCTGAAAAGGAAGGAAGCGTAACTATCTAC
CAAGCTTCGAGATTTTATAAATAGGTGGTCTCGTAATGTCCGATTTGGGA
AGTGGAGATGATGGCATCTCAGGATCAAAATATAATGTTGCAAATATGGA
GGGTTCCTCAAGTAGGAACGACTTCGATTCTTCTGCTAAAGGAGGAAGCG
GCGTCGAACAGGAATTGGCTACGAAAATGTTGCAAATACAATCTAAACGA
TTTTATTTGGATGTAAAACAAAATAGAAGAGGCCGTTTTATAAAGGTTGC
TGAGATTGGCGCTGATGGTAGACGAAGTCAAATTTACTTGGCTCTTTCAA
CTGCAGCCGAATTTCGTGACCATTTATCCTCATTTAGCGATTACTACGCT
TCTCTAGGTCCACCAAACACCGACAATTTGCCGGAAGATGGTAAACTTAA
ATCTGAAATGATGATAAAAGATTACAGAAGGTATTACTTGGACTTAAAAG
AAAATGCGCGTGGCCGATTTTTACGGGTATCGCAAACAATAACAAGAGGG
GGGCCTAGATCTCAAATCGCTTTACCGGCTCAAGGCATGATCGAGTTTCG
TGACGCTCTTACAGATTTGTTAGAAGAGTTTGGAGCTAATGATGGAGGGT
TTAAAGGAGATTTACCGGAAGAGCGACACATGAAGGTGGATAATAAAAAT
TTTTATTTTGATATCGGACAAAATAATCGAGGAGTGTACATGCGGATAAG
CGAAGTGAAAAATAACTTCCGGACTTCGATAACTATTCCAGAGAAATGTT
GGATTCGCTTTCGAGATATTTTTAATGATTATTGCGAGAAAATGAAAAAA
TCGTCCGACTCAATTACTGCCGAAATTAACTTACCTACATCTTCAAATAG
TCTTAAATAAACAACATACCGTGATTTACTAAGTTATATAAGAAGGCGCG
AAAATAAAATTTTTAATGGCGATTGACCAACCAATATATGTAAAGCTTGT
AATGTCTGACATGGCTAAATTCTAAATCATGCGACTAATTAAGCTTAATG
ACAAACAAATATATTTATTTTGTAGCATTTAGCCCAAAAAAAAAAAAAAA
AAA
LD15002.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:09:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pur-alpha-RA | 1423 | Pur-alpha-RA | 97..1383 | 1..1287 | 6435 | 100 | Plus |
Pur-alpha.af | 1722 | Pur-alpha.af | 286..1447 | 126..1287 | 5810 | 100 | Plus |
Pur-alpha-RC | 1450 | Pur-alpha-RC | 286..1447 | 126..1287 | 5810 | 100 | Plus |
Pur-alpha.af | 1722 | Pur-alpha.af | 29..154 | 1..126 | 630 | 100 | Plus |
Pur-alpha-RC | 1450 | Pur-alpha-RC | 29..154 | 1..126 | 630 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:16:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr4 | 1351717 | chr4 | 586150..586480 | 955..1285 | 1655 | 100 | Plus |
chr4 | 1351717 | chr4 | 580645..580849 | 124..328 | 1025 | 100 | Plus |
chr4 | 1351717 | chr4 | 578594..578719 | 1..126 | 630 | 100 | Plus |
chr4 | 1351717 | chr4 | 585089..585213 | 726..850 | 625 | 100 | Plus |
chr4 | 1351717 | chr4 | 584908..585031 | 606..729 | 620 | 100 | Plus |
chr4 | 1351717 | chr4 | 581018..581132 | 390..504 | 575 | 100 | Plus |
chr4 | 1351717 | chr4 | 585958..586066 | 848..956 | 545 | 100 | Plus |
chr4 | 1351717 | chr4 | 581265..581371 | 503..609 | 535 | 100 | Plus |
chr4 | 1351717 | chr4 | 580898..580961 | 329..392 | 320 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:02:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:16:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
4 | 1348131 | 4 | 565601..565933 | 955..1287 | 1665 | 100 | Plus |
4 | 1348131 | 4 | 560096..560300 | 124..328 | 1025 | 100 | Plus |
4 | 1348131 | 4 | 558044..558169 | 1..126 | 630 | 100 | Plus |
4 | 1348131 | 4 | 564540..564664 | 726..850 | 625 | 100 | Plus |
4 | 1348131 | 4 | 564359..564482 | 606..729 | 620 | 100 | Plus |
4 | 1348131 | 4 | 560469..560583 | 390..504 | 575 | 100 | Plus |
4 | 1348131 | 4 | 565409..565517 | 848..956 | 545 | 100 | Plus |
4 | 1348131 | 4 | 560716..560822 | 503..609 | 535 | 100 | Plus |
4 | 1348131 | 4 | 560349..560412 | 329..392 | 320 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
4 | 1331231 | 4 | 565601..565933 | 955..1287 | 1665 | 100 | Plus |
4 | 1331231 | 4 | 560096..560300 | 124..328 | 1025 | 100 | Plus |
4 | 1331231 | 4 | 558044..558169 | 1..126 | 630 | 100 | Plus |
4 | 1331231 | 4 | 564540..564664 | 726..850 | 625 | 100 | Plus |
4 | 1331231 | 4 | 564359..564482 | 606..729 | 620 | 100 | Plus |
4 | 1331231 | 4 | 560469..560583 | 390..504 | 575 | 100 | Plus |
4 | 1331231 | 4 | 565409..565517 | 848..956 | 545 | 100 | Plus |
4 | 1331231 | 4 | 560716..560822 | 503..609 | 535 | 100 | Plus |
4 | 1331231 | 4 | 560349..560412 | 329..392 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 15:16:56 has no hits.
LD15002.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:17:52 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr4 | 578594..578718 | 1..125 | 100 | -> | Plus |
chr4 | 580647..580849 | 126..328 | 100 | -> | Plus |
chr4 | 580898..580960 | 329..391 | 100 | -> | Plus |
chr4 | 581020..581132 | 392..504 | 100 | -> | Plus |
chr4 | 581267..581369 | 505..607 | 100 | -> | Plus |
chr4 | 584910..585028 | 608..726 | 100 | -> | Plus |
chr4 | 585090..585211 | 727..848 | 100 | -> | Plus |
chr4 | 585959..586064 | 849..954 | 100 | -> | Plus |
chr4 | 586150..586480 | 955..1285 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:24 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RC | 1..825 | 286..1110 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:52 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RC | 1..825 | 286..1110 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:55 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 1..825 | 286..1110 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:15:39 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RC | 1..825 | 286..1110 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:08 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 1..825 | 286..1110 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:30:30 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 63..1347 | 1..1285 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:52 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 63..1347 | 1..1285 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:55 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 29..1313 | 1..1285 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:15:40 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 63..1347 | 1..1285 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:08 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pur-alpha-RA | 29..1313 | 1..1285 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:52 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
4 | 558044..558168 | 1..125 | 100 | -> | Plus |
4 | 560098..560300 | 126..328 | 100 | -> | Plus |
4 | 560349..560411 | 329..391 | 100 | -> | Plus |
4 | 560471..560583 | 392..504 | 100 | -> | Plus |
4 | 560718..560820 | 505..607 | 100 | -> | Plus |
4 | 564361..564479 | 608..726 | 100 | -> | Plus |
4 | 564541..564662 | 727..848 | 100 | -> | Plus |
4 | 565410..565515 | 849..954 | 100 | -> | Plus |
4 | 565601..565931 | 955..1285 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:52 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
4 | 558044..558168 | 1..125 | 100 | -> | Plus |
4 | 560098..560300 | 126..328 | 100 | -> | Plus |
4 | 560349..560411 | 329..391 | 100 | -> | Plus |
4 | 560471..560583 | 392..504 | 100 | -> | Plus |
4 | 560718..560820 | 505..607 | 100 | -> | Plus |
4 | 564361..564479 | 608..726 | 100 | -> | Plus |
4 | 564541..564662 | 727..848 | 100 | -> | Plus |
4 | 565410..565515 | 849..954 | 100 | -> | Plus |
4 | 565601..565931 | 955..1285 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:52 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
4 | 558044..558168 | 1..125 | 100 | -> | Plus |
4 | 560098..560300 | 126..328 | 100 | -> | Plus |
4 | 560349..560411 | 329..391 | 100 | -> | Plus |
4 | 560471..560583 | 392..504 | 100 | -> | Plus |
4 | 560718..560820 | 505..607 | 100 | -> | Plus |
4 | 564361..564479 | 608..726 | 100 | -> | Plus |
4 | 564541..564662 | 727..848 | 100 | -> | Plus |
4 | 565410..565515 | 849..954 | 100 | -> | Plus |
4 | 565601..565931 | 955..1285 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:55 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_4 | 578670..578794 | 1..125 | 100 | -> | Plus |
arm_4 | 580724..580926 | 126..328 | 100 | -> | Plus |
arm_4 | 580975..581037 | 329..391 | 100 | -> | Plus |
arm_4 | 581097..581209 | 392..504 | 100 | -> | Plus |
arm_4 | 581344..581446 | 505..607 | 100 | -> | Plus |
arm_4 | 584987..585105 | 608..726 | 100 | -> | Plus |
arm_4 | 585167..585288 | 727..848 | 100 | -> | Plus |
arm_4 | 586036..586141 | 849..954 | 100 | -> | Plus |
arm_4 | 586227..586557 | 955..1285 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:52:28 Download gff for
LD15002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
4 | 560471..560583 | 392..504 | 100 | -> | Plus |
4 | 560718..560820 | 505..607 | 100 | -> | Plus |
4 | 564361..564479 | 608..726 | 100 | -> | Plus |
4 | 564541..564662 | 727..848 | 100 | -> | Plus |
4 | 565410..565515 | 849..954 | 100 | -> | Plus |
4 | 560098..560300 | 126..328 | 100 | -> | Plus |
4 | 560349..560411 | 329..391 | 100 | -> | Plus |
4 | 565601..565931 | 955..1285 | 100 | | Plus |
4 | 558044..558168 | 1..125 | 100 | -> | Plus |
LD15002.pep Sequence
Translation from 285 to 1109
> LD15002.pep
MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQ
IQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSF
SDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQ
TITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKGDLPEERHMK
VDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYC
EKMKKSSDSITAEINLPTSSNSLK*
LD15002.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:01:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22832-PA | 86 | GF22832-PA | 1..86 | 189..274 | 444 | 94.2 | Plus |
Dana\GF22830-PA | 137 | GF22830-PA | 1..109 | 1..106 | 345 | 65.5 | Plus |
Dana\GF22830-PA | 137 | GF22830-PA | 42..113 | 120..188 | 279 | 73.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:01:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16390-PA | 274 | GG16390-PA | 1..274 | 1..274 | 1443 | 98.9 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:01:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH24015-PA | 188 | GH24015-PA | 1..188 | 1..188 | 918 | 93.6 | Plus |
Dgri\GH24015-PA | 188 | GH24015-PA | 43..181 | 120..252 | 206 | 33.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pur-alpha-PE | 274 | CG1507-PE | 1..274 | 1..274 | 1416 | 100 | Plus |
Pur-alpha-PC | 274 | CG1507-PC | 1..274 | 1..274 | 1416 | 100 | Plus |
Pur-alpha-PA | 274 | CG1507-PA | 1..274 | 1..274 | 1416 | 100 | Plus |
Pur-alpha-PF | 275 | CG1507-PF | 1..275 | 1..274 | 1404 | 99.6 | Plus |
Pur-alpha-PB | 275 | CG1507-PB | 1..275 | 1..274 | 1404 | 99.6 | Plus |
Pur-alpha-PG | 259 | CG1507-PG | 7..259 | 22..274 | 1305 | 99.6 | Plus |
Pur-alpha-PD | 260 | CG1507-PD | 7..260 | 22..274 | 1293 | 99.2 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:01:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI14049-PA | 273 | GI14049-PA | 1..273 | 1..274 | 1328 | 91.2 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:01:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL18143-PA | 275 | GL18143-PA | 1..275 | 1..274 | 1401 | 96.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:01:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26800-PA | 275 | GM26800-PA | 1..275 | 1..274 | 1436 | 99.3 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:01:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ19804-PA | 274 | GJ19804-PA | 1..274 | 1..274 | 1351 | 92.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:01:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13584-PA | 274 | GK13584-PA | 1..274 | 1..274 | 1367 | 93.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:01:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14552-PA | 274 | GE14552-PA | 1..274 | 1..274 | 1437 | 98.5 | Plus |
LD15002.hyp Sequence
Translation from 285 to 1109
> LD15002.hyp
MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQ
IQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSF
SDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQ
TITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKGDLPEERHMK
VDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYC
EKMKKSSDSITAEINLPTSSNSLK*
LD15002.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pur-alpha-PE | 274 | CG1507-PE | 1..274 | 1..274 | 1416 | 100 | Plus |
Pur-alpha-PC | 274 | CG1507-PC | 1..274 | 1..274 | 1416 | 100 | Plus |
Pur-alpha-PA | 274 | CG1507-PA | 1..274 | 1..274 | 1416 | 100 | Plus |
Pur-alpha-PF | 275 | CG1507-PF | 1..275 | 1..274 | 1404 | 99.6 | Plus |
Pur-alpha-PB | 275 | CG1507-PB | 1..275 | 1..274 | 1404 | 99.6 | Plus |