Clone LD15002 Report

Search the DGRC for LD15002

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:150
Well:2
Vector:pBS SK-
Associated Gene/TranscriptPur-alpha-RA
Protein status:LD15002.pep: gold
Preliminary Size:1461
Sequenced Size:1303

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1507 2001-01-01 Release 2 assignment
CG1507 2001-10-10 Blastp of sequenced clone
CG1507 2003-01-01 Sim4 clustering to Release 3
Pur-alpha 2008-04-29 Release 5.5 accounting
Pur-alpha 2008-08-15 Release 5.9 accounting
Pur-alpha 2008-12-18 5.12 accounting

Clone Sequence Records

LD15002.complete Sequence

1303 bp (1303 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061185

> LD15002.complete
CAAACTAGGCCATTTTACTCAATCTACACATAAACATTGACTGTACAACA
TGCTCAAGCTTTCGCTGTGACTCAAAAACACTCCAAAACTCGGATTTGCA
TCAGTCTTCCTACAAAGGCGTTAAGGGGAATGTTGTACACCGGACAAAAA
GAATGGTTATACTATTAACTATATGCTGTCGTGTTGAGGCACAAGAGTAG
TGTAACATTAAAAGTGTGTCGCTGAAAAGGAAGGAAGCGTAACTATCTAC
CAAGCTTCGAGATTTTATAAATAGGTGGTCTCGTAATGTCCGATTTGGGA
AGTGGAGATGATGGCATCTCAGGATCAAAATATAATGTTGCAAATATGGA
GGGTTCCTCAAGTAGGAACGACTTCGATTCTTCTGCTAAAGGAGGAAGCG
GCGTCGAACAGGAATTGGCTACGAAAATGTTGCAAATACAATCTAAACGA
TTTTATTTGGATGTAAAACAAAATAGAAGAGGCCGTTTTATAAAGGTTGC
TGAGATTGGCGCTGATGGTAGACGAAGTCAAATTTACTTGGCTCTTTCAA
CTGCAGCCGAATTTCGTGACCATTTATCCTCATTTAGCGATTACTACGCT
TCTCTAGGTCCACCAAACACCGACAATTTGCCGGAAGATGGTAAACTTAA
ATCTGAAATGATGATAAAAGATTACAGAAGGTATTACTTGGACTTAAAAG
AAAATGCGCGTGGCCGATTTTTACGGGTATCGCAAACAATAACAAGAGGG
GGGCCTAGATCTCAAATCGCTTTACCGGCTCAAGGCATGATCGAGTTTCG
TGACGCTCTTACAGATTTGTTAGAAGAGTTTGGAGCTAATGATGGAGGGT
TTAAAGGAGATTTACCGGAAGAGCGACACATGAAGGTGGATAATAAAAAT
TTTTATTTTGATATCGGACAAAATAATCGAGGAGTGTACATGCGGATAAG
CGAAGTGAAAAATAACTTCCGGACTTCGATAACTATTCCAGAGAAATGTT
GGATTCGCTTTCGAGATATTTTTAATGATTATTGCGAGAAAATGAAAAAA
TCGTCCGACTCAATTACTGCCGAAATTAACTTACCTACATCTTCAAATAG
TCTTAAATAAACAACATACCGTGATTTACTAAGTTATATAAGAAGGCGCG
AAAATAAAATTTTTAATGGCGATTGACCAACCAATATATGTAAAGCTTGT
AATGTCTGACATGGCTAAATTCTAAATCATGCGACTAATTAAGCTTAATG
ACAAACAAATATATTTATTTTGTAGCATTTAGCCCAAAAAAAAAAAAAAA
AAA

LD15002.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Pur-alpha-RA 1423 Pur-alpha-RA 97..1383 1..1287 6435 100 Plus
Pur-alpha.af 1722 Pur-alpha.af 286..1447 126..1287 5810 100 Plus
Pur-alpha-RC 1450 Pur-alpha-RC 286..1447 126..1287 5810 100 Plus
Pur-alpha.af 1722 Pur-alpha.af 29..154 1..126 630 100 Plus
Pur-alpha-RC 1450 Pur-alpha-RC 29..154 1..126 630 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 586150..586480 955..1285 1655 100 Plus
chr4 1351717 chr4 580645..580849 124..328 1025 100 Plus
chr4 1351717 chr4 578594..578719 1..126 630 100 Plus
chr4 1351717 chr4 585089..585213 726..850 625 100 Plus
chr4 1351717 chr4 584908..585031 606..729 620 100 Plus
chr4 1351717 chr4 581018..581132 390..504 575 100 Plus
chr4 1351717 chr4 585958..586066 848..956 545 100 Plus
chr4 1351717 chr4 581265..581371 503..609 535 100 Plus
chr4 1351717 chr4 580898..580961 329..392 320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:02:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 565601..565933 955..1287 1665 100 Plus
4 1348131 4 560096..560300 124..328 1025 100 Plus
4 1348131 4 558044..558169 1..126 630 100 Plus
4 1348131 4 564540..564664 726..850 625 100 Plus
4 1348131 4 564359..564482 606..729 620 100 Plus
4 1348131 4 560469..560583 390..504 575 100 Plus
4 1348131 4 565409..565517 848..956 545 100 Plus
4 1348131 4 560716..560822 503..609 535 100 Plus
4 1348131 4 560349..560412 329..392 320 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 565601..565933 955..1287 1665 100 Plus
4 1331231 4 560096..560300 124..328 1025 100 Plus
4 1331231 4 558044..558169 1..126 630 100 Plus
4 1331231 4 564540..564664 726..850 625 100 Plus
4 1331231 4 564359..564482 606..729 620 100 Plus
4 1331231 4 560469..560583 390..504 575 100 Plus
4 1331231 4 565409..565517 848..956 545 100 Plus
4 1331231 4 560716..560822 503..609 535 100 Plus
4 1331231 4 560349..560412 329..392 320 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:16:56 has no hits.

LD15002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:17:52 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 578594..578718 1..125 100 -> Plus
chr4 580647..580849 126..328 100 -> Plus
chr4 580898..580960 329..391 100 -> Plus
chr4 581020..581132 392..504 100 -> Plus
chr4 581267..581369 505..607 100 -> Plus
chr4 584910..585028 608..726 100 -> Plus
chr4 585090..585211 727..848 100 -> Plus
chr4 585959..586064 849..954 100 -> Plus
chr4 586150..586480 955..1285 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:24 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RC 1..825 286..1110 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:52 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RC 1..825 286..1110 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:55 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 1..825 286..1110 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:15:39 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RC 1..825 286..1110 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:08 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 1..825 286..1110 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:30:30 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 63..1347 1..1285 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:52 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 63..1347 1..1285 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:55 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 29..1313 1..1285 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:15:40 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 63..1347 1..1285 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:08 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
Pur-alpha-RA 29..1313 1..1285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:52 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
4 558044..558168 1..125 100 -> Plus
4 560098..560300 126..328 100 -> Plus
4 560349..560411 329..391 100 -> Plus
4 560471..560583 392..504 100 -> Plus
4 560718..560820 505..607 100 -> Plus
4 564361..564479 608..726 100 -> Plus
4 564541..564662 727..848 100 -> Plus
4 565410..565515 849..954 100 -> Plus
4 565601..565931 955..1285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:52 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
4 558044..558168 1..125 100 -> Plus
4 560098..560300 126..328 100 -> Plus
4 560349..560411 329..391 100 -> Plus
4 560471..560583 392..504 100 -> Plus
4 560718..560820 505..607 100 -> Plus
4 564361..564479 608..726 100 -> Plus
4 564541..564662 727..848 100 -> Plus
4 565410..565515 849..954 100 -> Plus
4 565601..565931 955..1285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:52 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
4 558044..558168 1..125 100 -> Plus
4 560098..560300 126..328 100 -> Plus
4 560349..560411 329..391 100 -> Plus
4 560471..560583 392..504 100 -> Plus
4 560718..560820 505..607 100 -> Plus
4 564361..564479 608..726 100 -> Plus
4 564541..564662 727..848 100 -> Plus
4 565410..565515 849..954 100 -> Plus
4 565601..565931 955..1285 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:55 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 578670..578794 1..125 100 -> Plus
arm_4 580724..580926 126..328 100 -> Plus
arm_4 580975..581037 329..391 100 -> Plus
arm_4 581097..581209 392..504 100 -> Plus
arm_4 581344..581446 505..607 100 -> Plus
arm_4 584987..585105 608..726 100 -> Plus
arm_4 585167..585288 727..848 100 -> Plus
arm_4 586036..586141 849..954 100 -> Plus
arm_4 586227..586557 955..1285 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:52:28 Download gff for LD15002.complete
Subject Subject Range Query Range Percent Splice Strand
4 560471..560583 392..504 100 -> Plus
4 560718..560820 505..607 100 -> Plus
4 564361..564479 608..726 100 -> Plus
4 564541..564662 727..848 100 -> Plus
4 565410..565515 849..954 100 -> Plus
4 560098..560300 126..328 100 -> Plus
4 560349..560411 329..391 100 -> Plus
4 565601..565931 955..1285 100   Plus
4 558044..558168 1..125 100 -> Plus

LD15002.pep Sequence

Translation from 285 to 1109

> LD15002.pep
MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQ
IQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSF
SDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQ
TITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKGDLPEERHMK
VDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYC
EKMKKSSDSITAEINLPTSSNSLK*

LD15002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22832-PA 86 GF22832-PA 1..86 189..274 444 94.2 Plus
Dana\GF22830-PA 137 GF22830-PA 1..109 1..106 345 65.5 Plus
Dana\GF22830-PA 137 GF22830-PA 42..113 120..188 279 73.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16390-PA 274 GG16390-PA 1..274 1..274 1443 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24015-PA 188 GH24015-PA 1..188 1..188 918 93.6 Plus
Dgri\GH24015-PA 188 GH24015-PA 43..181 120..252 206 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Pur-alpha-PE 274 CG1507-PE 1..274 1..274 1416 100 Plus
Pur-alpha-PC 274 CG1507-PC 1..274 1..274 1416 100 Plus
Pur-alpha-PA 274 CG1507-PA 1..274 1..274 1416 100 Plus
Pur-alpha-PF 275 CG1507-PF 1..275 1..274 1404 99.6 Plus
Pur-alpha-PB 275 CG1507-PB 1..275 1..274 1404 99.6 Plus
Pur-alpha-PG 259 CG1507-PG 7..259 22..274 1305 99.6 Plus
Pur-alpha-PD 260 CG1507-PD 7..260 22..274 1293 99.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14049-PA 273 GI14049-PA 1..273 1..274 1328 91.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18143-PA 275 GL18143-PA 1..275 1..274 1401 96.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26800-PA 275 GM26800-PA 1..275 1..274 1436 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19804-PA 274 GJ19804-PA 1..274 1..274 1351 92.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13584-PA 274 GK13584-PA 1..274 1..274 1367 93.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14552-PA 274 GE14552-PA 1..274 1..274 1437 98.5 Plus

LD15002.hyp Sequence

Translation from 285 to 1109

> LD15002.hyp
MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQ
IQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSF
SDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQ
TITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKGDLPEERHMK
VDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYC
EKMKKSSDSITAEINLPTSSNSLK*

LD15002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Pur-alpha-PE 274 CG1507-PE 1..274 1..274 1416 100 Plus
Pur-alpha-PC 274 CG1507-PC 1..274 1..274 1416 100 Plus
Pur-alpha-PA 274 CG1507-PA 1..274 1..274 1416 100 Plus
Pur-alpha-PF 275 CG1507-PF 1..275 1..274 1404 99.6 Plus
Pur-alpha-PB 275 CG1507-PB 1..275 1..274 1404 99.6 Plus