![]() | BDGP Sequence Production Resources |
Search the DGRC for LD15606
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 156 |
Well: | 6 |
Vector: | pBS SK- |
Associated Gene/Transcript | Paip2-RA |
Protein status: | LD15606.pep: gold |
Preliminary Size: | 1226 |
Sequenced Size: | 1030 |
Gene | Date | Evidence |
---|---|---|
CG12358 | 2001-01-01 | Release 2 assignment |
CG12358 | 2001-10-10 | Blastp of sequenced clone |
CG12358 | 2003-01-01 | Sim4 clustering to Release 3 |
Paip2 | 2008-04-29 | Release 5.5 accounting |
Paip2 | 2008-08-15 | Release 5.9 accounting |
Paip2 | 2008-12-18 | 5.12 accounting |
1030 bp (1030 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061203
> LD15606.complete TTGCTTGACGTTCACTGACGTGATTCCGCACACAGCACATAGTCGAATAC GTTTCGCAATAGAAATATCAAAATTCTCCGTGTGGACTCAATCTGGATTG GATGCAACACTAAATTACCAGTGTTTTCCTCGATTTTCTAGCGACGCAAA ATTCTCAGTACAACCCAAAAAAAAAACGGAGAGTCTCTTCAACAACAAAA TCAAGCATCATCGATAAAAACAACAAGTCTCCCGGAGGAAGTGGCTCCAA AATATCCAGTGCAACAGCGGACGAACTTCTCGGCAGGATTGAGACCAATA TGTTGTTAAAAGTGCCATCTGTGGACTGGACGGATCAAATAATTTACGTA GTGGACGACGACGAGTCGCTGTCAGACATCGACGATGAGCCAGATTTTTC CGAATACATGTGGATGGAGAACGAGGAGGAGTTCGACAAGAACGAACTGC AACGGCTGGAGGAGGAAGAGATTATGCAGGAGTGTTTTGAAGCCATGATA GAAGACGAGCTGGAGGAGCAGATCAACGAATGGGAGAAGGCCAAGACGGA CGAGCAGAACACGGCACTTTCCGCACTACCCAAGAGCCAGTGTGATGTTG AAAAGTCTGTTCTGAATCCGATGGCTGATGAGTTTGTTCCGCGTTGTCAT GTTATAGATTTCCCTGCCTCATAAAGCCAGCCCATATCTCCTGCCCGCCA CAGAATCACAAACTACCCCGAACCCGTACCACGTGGACCTCATACGCGAA AAACCTTAGATAAACTGAAGACCCATTGCTAAGACTAGACTAACAGATTC CGCTAATGAGATTGATATTGATATTCTGACCAAGTTGAGCCAGATGGAGC ATTGGGAGCAGTGGCTCATGAATATCTTATTTCTAGATACCAAAATGCTG GAAAAGAAAACTAAATATACCAACAAACTCCAAATGCTGGCGACCGAAAT GCAAACGAATCATATTAAAAAAAAAACCTTATAAAAAACAACTGAACCAC TGCAAAAATACAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 8809365..8809832 | 545..1011 | 2290 | 99.8 | Plus |
chr3R | 27901430 | chr3R | 8806334..8806632 | 1..294 | 1370 | 98 | Plus |
chr3R | 27901430 | chr3R | 8808989..8809138 | 295..444 | 750 | 100 | Plus |
chr3R | 27901430 | chr3R | 8809201..8809302 | 444..545 | 510 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 12984111..12984583 | 545..1017 | 2365 | 100 | Plus |
3R | 32079331 | 3R | 12981094..12981387 | 1..294 | 1470 | 100 | Plus |
3R | 32079331 | 3R | 12983735..12983884 | 295..444 | 750 | 100 | Plus |
3R | 32079331 | 3R | 12983947..12984048 | 444..545 | 510 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 12724942..12725414 | 545..1017 | 2365 | 100 | Plus |
3R | 31820162 | 3R | 12721925..12722218 | 1..294 | 1470 | 100 | Plus |
3R | 31820162 | 3R | 12724566..12724715 | 295..444 | 750 | 100 | Plus |
3R | 31820162 | 3R | 12724778..12724879 | 444..545 | 510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8806334..8806632 | 1..294 | 97 | -> | Plus |
chr3R | 8808989..8809137 | 295..443 | 100 | -> | Plus |
chr3R | 8809201..8809301 | 444..544 | 100 | -> | Plus |
chr3R | 8809365..8809832 | 545..1011 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 1..375 | 300..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 1..375 | 300..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 1..375 | 300..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 1..375 | 300..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 1..375 | 300..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 49..1059 | 1..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 49..1059 | 1..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 49..1059 | 1..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 49..1059 | 1..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Paip2-RA | 49..1059 | 1..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12981094..12981387 | 1..294 | 100 | -> | Plus |
3R | 12983735..12983883 | 295..443 | 100 | -> | Plus |
3R | 12983947..12984047 | 444..544 | 100 | -> | Plus |
3R | 12984111..12984577 | 545..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12981094..12981387 | 1..294 | 100 | -> | Plus |
3R | 12983735..12983883 | 295..443 | 100 | -> | Plus |
3R | 12983947..12984047 | 444..544 | 100 | -> | Plus |
3R | 12984111..12984577 | 545..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12981094..12981387 | 1..294 | 100 | -> | Plus |
3R | 12983735..12983883 | 295..443 | 100 | -> | Plus |
3R | 12983947..12984047 | 444..544 | 100 | -> | Plus |
3R | 12984111..12984577 | 545..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8809669..8809769 | 444..544 | 100 | -> | Plus |
arm_3R | 8806816..8807109 | 1..294 | 100 | -> | Plus |
arm_3R | 8809457..8809605 | 295..443 | 100 | -> | Plus |
arm_3R | 8809833..8810299 | 545..1011 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12724566..12724714 | 295..443 | 100 | -> | Plus |
3R | 12724778..12724878 | 444..544 | 100 | -> | Plus |
3R | 12724942..12725408 | 545..1011 | 100 | Plus | |
3R | 12721925..12722218 | 1..294 | 100 | -> | Plus |
Translation from 299 to 673
> LD15606.hyp MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNEL QRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDV EKSVLNPMADEFVPRCHVIDFPAS*
Translation from 299 to 673
> LD15606.pep MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNEL QRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDV EKSVLNPMADEFVPRCHVIDFPAS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16924-PA | 124 | GF16924-PA | 1..124 | 1..124 | 604 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19302-PA | 124 | GG19302-PA | 1..124 | 1..124 | 629 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18363-PA | 124 | GH18363-PA | 1..124 | 1..124 | 585 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Paip2-PB | 124 | CG12358-PB | 1..124 | 1..124 | 656 | 100 | Plus |
Paip2-PA | 124 | CG12358-PA | 1..124 | 1..124 | 656 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23353-PA | 124 | GI23353-PA | 1..124 | 1..124 | 583 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24376-PA | 124 | GL24376-PA | 1..124 | 1..124 | 579 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11578-PA | 124 | GA11578-PA | 1..124 | 1..124 | 579 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24070-PA | 124 | GM24070-PA | 1..124 | 1..124 | 629 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18867-PA | 124 | GD18867-PA | 1..124 | 1..124 | 629 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10346-PA | 124 | GJ10346-PA | 1..124 | 1..124 | 588 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12218-PA | 124 | GK12218-PA | 1..124 | 1..124 | 602 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26228-PA | 124 | GE26228-PA | 1..124 | 1..124 | 629 | 100 | Plus |