Clone LD15606 Report

Search the DGRC for LD15606

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:156
Well:6
Vector:pBS SK-
Associated Gene/TranscriptPaip2-RA
Protein status:LD15606.pep: gold
Preliminary Size:1226
Sequenced Size:1030

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12358 2001-01-01 Release 2 assignment
CG12358 2001-10-10 Blastp of sequenced clone
CG12358 2003-01-01 Sim4 clustering to Release 3
Paip2 2008-04-29 Release 5.5 accounting
Paip2 2008-08-15 Release 5.9 accounting
Paip2 2008-12-18 5.12 accounting

Clone Sequence Records

LD15606.complete Sequence

1030 bp (1030 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061203

> LD15606.complete
TTGCTTGACGTTCACTGACGTGATTCCGCACACAGCACATAGTCGAATAC
GTTTCGCAATAGAAATATCAAAATTCTCCGTGTGGACTCAATCTGGATTG
GATGCAACACTAAATTACCAGTGTTTTCCTCGATTTTCTAGCGACGCAAA
ATTCTCAGTACAACCCAAAAAAAAAACGGAGAGTCTCTTCAACAACAAAA
TCAAGCATCATCGATAAAAACAACAAGTCTCCCGGAGGAAGTGGCTCCAA
AATATCCAGTGCAACAGCGGACGAACTTCTCGGCAGGATTGAGACCAATA
TGTTGTTAAAAGTGCCATCTGTGGACTGGACGGATCAAATAATTTACGTA
GTGGACGACGACGAGTCGCTGTCAGACATCGACGATGAGCCAGATTTTTC
CGAATACATGTGGATGGAGAACGAGGAGGAGTTCGACAAGAACGAACTGC
AACGGCTGGAGGAGGAAGAGATTATGCAGGAGTGTTTTGAAGCCATGATA
GAAGACGAGCTGGAGGAGCAGATCAACGAATGGGAGAAGGCCAAGACGGA
CGAGCAGAACACGGCACTTTCCGCACTACCCAAGAGCCAGTGTGATGTTG
AAAAGTCTGTTCTGAATCCGATGGCTGATGAGTTTGTTCCGCGTTGTCAT
GTTATAGATTTCCCTGCCTCATAAAGCCAGCCCATATCTCCTGCCCGCCA
CAGAATCACAAACTACCCCGAACCCGTACCACGTGGACCTCATACGCGAA
AAACCTTAGATAAACTGAAGACCCATTGCTAAGACTAGACTAACAGATTC
CGCTAATGAGATTGATATTGATATTCTGACCAAGTTGAGCCAGATGGAGC
ATTGGGAGCAGTGGCTCATGAATATCTTATTTCTAGATACCAAAATGCTG
GAAAAGAAAACTAAATATACCAACAAACTCCAAATGCTGGCGACCGAAAT
GCAAACGAATCATATTAAAAAAAAAACCTTATAAAAAACAACTGAACCAC
TGCAAAAATACAAAAAAAAAAAAAAAAAAA

LD15606.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2.h 2090 Paip2.h 62..1078 1..1017 5085 100 Plus
Paip2-RA 1118 Paip2-RA 62..1078 1..1017 5085 100 Plus
Paip2.g 1111 Paip2.g 70..1051 36..1017 4910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8809365..8809832 545..1011 2290 99.8 Plus
chr3R 27901430 chr3R 8806334..8806632 1..294 1370 98 Plus
chr3R 27901430 chr3R 8808989..8809138 295..444 750 100 Plus
chr3R 27901430 chr3R 8809201..8809302 444..545 510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:03:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12984111..12984583 545..1017 2365 100 Plus
3R 32079331 3R 12981094..12981387 1..294 1470 100 Plus
3R 32079331 3R 12983735..12983884 295..444 750 100 Plus
3R 32079331 3R 12983947..12984048 444..545 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12724942..12725414 545..1017 2365 100 Plus
3R 31820162 3R 12721925..12722218 1..294 1470 100 Plus
3R 31820162 3R 12724566..12724715 295..444 750 100 Plus
3R 31820162 3R 12724778..12724879 444..545 510 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:21:37 has no hits.

LD15606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:22:45 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8806334..8806632 1..294 97 -> Plus
chr3R 8808989..8809137 295..443 100 -> Plus
chr3R 8809201..8809301 444..544 100 -> Plus
chr3R 8809365..8809832 545..1011 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:50:16 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 1..375 300..674 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:28 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 1..375 300..674 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:16:11 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 1..375 300..674 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:12 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 1..375 300..674 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:01 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 1..375 300..674 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:46 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 49..1059 1..1011 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:28 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 49..1059 1..1011 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:16:11 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 49..1059 1..1011 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:12 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 49..1059 1..1011 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:01 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 49..1059 1..1011 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:45 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12981094..12981387 1..294 100 -> Plus
3R 12983735..12983883 295..443 100 -> Plus
3R 12983947..12984047 444..544 100 -> Plus
3R 12984111..12984577 545..1011 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:45 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12981094..12981387 1..294 100 -> Plus
3R 12983735..12983883 295..443 100 -> Plus
3R 12983947..12984047 444..544 100 -> Plus
3R 12984111..12984577 545..1011 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:45 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12981094..12981387 1..294 100 -> Plus
3R 12983735..12983883 295..443 100 -> Plus
3R 12983947..12984047 444..544 100 -> Plus
3R 12984111..12984577 545..1011 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:16:11 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8809669..8809769 444..544 100 -> Plus
arm_3R 8806816..8807109 1..294 100 -> Plus
arm_3R 8809457..8809605 295..443 100 -> Plus
arm_3R 8809833..8810299 545..1011 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:11 Download gff for LD15606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12724566..12724714 295..443 100 -> Plus
3R 12724778..12724878 444..544 100 -> Plus
3R 12724942..12725408 545..1011 100   Plus
3R 12721925..12722218 1..294 100 -> Plus

LD15606.hyp Sequence

Translation from 299 to 673

> LD15606.hyp
MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNEL
QRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDV
EKSVLNPMADEFVPRCHVIDFPAS*

LD15606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-PB 124 CG12358-PB 1..124 1..124 656 100 Plus
Paip2-PA 124 CG12358-PA 1..124 1..124 656 100 Plus

LD15606.pep Sequence

Translation from 299 to 673

> LD15606.pep
MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNEL
QRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDV
EKSVLNPMADEFVPRCHVIDFPAS*

LD15606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16924-PA 124 GF16924-PA 1..124 1..124 604 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19302-PA 124 GG19302-PA 1..124 1..124 629 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18363-PA 124 GH18363-PA 1..124 1..124 585 92.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-PB 124 CG12358-PB 1..124 1..124 656 100 Plus
Paip2-PA 124 CG12358-PA 1..124 1..124 656 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23353-PA 124 GI23353-PA 1..124 1..124 583 91.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24376-PA 124 GL24376-PA 1..124 1..124 579 89.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11578-PA 124 GA11578-PA 1..124 1..124 579 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24070-PA 124 GM24070-PA 1..124 1..124 629 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18867-PA 124 GD18867-PA 1..124 1..124 629 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10346-PA 124 GJ10346-PA 1..124 1..124 588 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12218-PA 124 GK12218-PA 1..124 1..124 602 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26228-PA 124 GE26228-PA 1..124 1..124 629 100 Plus