Clone LD15851 Report

Search the DGRC for LD15851

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:158
Well:51
Vector:pBS SK-
Associated Gene/Transcriptchic-RB
Protein status:LD15851.pep: gold
Preliminary Size:1445
Sequenced Size:1073

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9553 2001-01-01 Release 2 assignment
CG9553 2001-11-29 Blastp of sequenced clone
CG9553 2003-01-01 Sim4 clustering to Release 3
chic 2008-04-29 Release 5.5 accounting
chic 2008-08-15 Release 5.9 accounting
chic 2008-12-18 5.12 accounting

Clone Sequence Records

LD15851.complete Sequence

1073 bp (1073 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069444

> LD15851.complete
CCAGGTTGGTTTCTATCTTTAAAAAATTATGATATTTTAGTACGAAAGGA
CCAAATATCAAAATAATTATATTTTTTATAAGAATATTATTAATATAAAA
AAAAAAAAAAAAAAAAACTCGAAAGTAAGTTACCCCAAGAAAAAATCGTC
GGTGTTGCGGTTTTTCTTTGTCTCCCTGCCAATTTCGTGTGACCCCCGAA
ACGAAAGTGCGACTCGCCGTGCGGTAAAGCAACAGCGATCCATATCCAGA
TCCATATATATCAGTTCAACTTAATCCGCACCCACGACAAACAAAGCACC
ATGAGCTGGCAAGATTATGTGGACAACCAACTCCTGGCCTCGCAGTGCGT
GACCAAGGCGTGCATCGCCGGCCACGACGGCAACATTTGGGCGCAGTCCA
GTGGCTTTGAGGTGACAAAAGAGGAGCTCTCCAAACTGATCAGCGGCTTT
GACCAGCAGGACGGTCTCACCAGCAACGGCGTGACACTCGCCGGCCAGCG
GTACATTTACCTTTCCGGCACAGACCGCGTGGTGCGCGCCAAGCTCGGCC
GGAGCGGAGTGCACTGCATGAAGACAACACAAGCCGTGATCGTTTCCATC
TACGAGGATCCCGTTCAGCCCCAGCAGGCCGCTTCCGTGGTAGAGAAACT
TGGAGATTATCTGATTACTTGCGGGTACTAGGAGAATAGATCAACACAAA
CACCCCCATCAACCACAACAACAACAACACACACACACCAACAACTACAA
CTACAACAACAACAGCAGCAACAAATTTGATAAGAGCGAACCGTAAATGA
ACTAATAACACATAAAAAGTAATTATTAATATTTAAATTTATGGGAAAAG
AAAAACCAACGGCCAAGAAAGAATTTGCGGTTTTTTGTGTGTAGCAGAGG
AAATGGATCGAGTAAAAATGCATATGCTTGAAAGAAAAAAAAAATGTCAA
AAAACGCAAATAACTACCCAACTACAAAAAAATTATAAATTTCTGCATTA
TTATATTTAAAACTTTTTGGTTTATACGATAAAAATAAAAGGAAAACACA
AAACTAAAAAAAAAAAAAAAAAA

LD15851.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
chic.m 2377 chic.m 362..1302 121..1061 4690 99.8 Plus
chic-RD 1313 chic-RD 76..1016 121..1061 4690 99.8 Plus
chic.g 2035 chic.g 270..1210 121..1061 4690 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5972254..5972727 1055..582 2370 100 Minus
chr2L 23010047 chr2L 5978459..5978753 415..121 1475 100 Minus
chr2L 23010047 chr2L 5975662..5975835 583..410 870 100 Minus
chrU 10048995 chrU 5301226..5301325 100..1 500 100 Minus
chrM 19516 chrM 12732..12831 100..1 500 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
mt:lrRNA-RA 1325 CR34094-RA 1227..1325 1..99 495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5973197..5973676 1061..582 2385 99.8 Minus
2L 23513712 2L 5979408..5979702 415..121 1475 100 Minus
2L 23513712 2L 5976611..5976784 583..410 870 100 Minus
M 19908 M 13119..13218 100..1 500 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5973197..5973676 1061..582 2385 99.7 Minus
2L 23513712 2L 5979408..5979702 415..121 1475 100 Minus
2L 23513712 2L 5976611..5976784 583..410 870 100 Minus
Blast to na_te.dros performed 2019-03-16 11:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker 7256 Stalker STALKER 7256bp 6486..6611 928..1053 125 57.5 Plus
accord2 7650 accord2 QBERT 7650bp 5836..5884 963..914 112 72 Minus

LD15851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:22:40 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5972600..5972725 584..709 100 <- Minus
chr2L 5975662..5975833 412..583 100 <- Minus
chr2L 5978463..5978755 119..411 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:50:35 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 1..381 301..681 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:23:47 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 1..381 301..681 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:05 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RD 1..381 301..681 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:50:29 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 1..381 301..681 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:50 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RD 1..381 301..681 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:03:29 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
mt:lrRNA-RA 1227..1325 1..99 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:59:06 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 162..1096 121..1055 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:23:47 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 162..1096 121..1055 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:05 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 165..1099 121..1055 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:50:29 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 162..1096 121..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:50 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
chic-RB 165..1099 121..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:22:40 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5973203..5973674 584..1055 100 <- Minus
2L 5976611..5976782 412..583 100 <- Minus
2L 5979412..5979704 119..411 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:22:40 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5973203..5973674 584..1055 100 <- Minus
2L 5976611..5976782 412..583 100 <- Minus
2L 5979412..5979704 119..411 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:22:40 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5973203..5973674 584..1055 100 <- Minus
2L 5976611..5976782 412..583 100 <- Minus
2L 5979412..5979704 119..411 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:05 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5973203..5973674 584..1055 100 <- Minus
arm_2L 5976611..5976782 412..583 100 <- Minus
arm_2L 5979412..5979704 119..411 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:26:53 Download gff for LD15851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5973203..5973674 584..1055 100 <- Minus
2L 5976611..5976782 412..583 100 <- Minus
2L 5979412..5979704 119..411 99 <- Minus

LD15851.pep Sequence

Translation from 300 to 680

> LD15851.pep
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGF
DQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSI
YEDPVQPQQAASVVEKLGDYLITCGY*

LD15851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14290-PA 153 GF14290-PA 1..153 1..126 617 80.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24265-PA 126 GG24265-PA 1..126 1..126 662 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10716-PA 126 GH10716-PA 1..126 1..126 647 96.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
chic-PF 126 CG9553-PF 1..126 1..126 656 100 Plus
chic-PE 126 CG9553-PE 1..126 1..126 656 100 Plus
chic-PD 126 CG9553-PD 1..126 1..126 656 100 Plus
chic-PB 126 CG9553-PB 1..126 1..126 656 100 Plus
chic-PC 126 CG9553-PC 1..126 1..126 656 100 Plus
chic-PA 126 CG9553-PA 1..126 1..126 656 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11304-PA 126 GI11304-PA 1..126 1..126 647 96.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19093-PA 130 GL19093-PA 1..130 1..126 523 82.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21874-PA 126 GA21874-PA 1..126 1..126 650 96.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17979-PA 126 GM17979-PA 1..126 1..126 662 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\chic-PA 142 GD22617-PA 1..142 1..126 498 72.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12548-PA 126 GJ12548-PA 1..126 1..126 641 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15407-PA 126 GK15407-PA 1..126 1..126 651 97.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18963-PA 126 GE18963-PA 1..126 1..126 662 99.2 Plus

LD15851.hyp Sequence

Translation from 300 to 680

> LD15851.hyp
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGF
DQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSI
YEDPVQPQQAASVVEKLGDYLITCGY*

LD15851.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
chic-PF 126 CG9553-PF 1..126 1..126 656 100 Plus
chic-PE 126 CG9553-PE 1..126 1..126 656 100 Plus
chic-PD 126 CG9553-PD 1..126 1..126 656 100 Plus
chic-PB 126 CG9553-PB 1..126 1..126 656 100 Plus
chic-PC 126 CG9553-PC 1..126 1..126 656 100 Plus