Clone LD16147 Report

Search the DGRC for LD16147

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:161
Well:47
Vector:pBS SK-
Associated Gene/Transcriptcold-RA
Protein status:LD16147.pep: gold
Preliminary Size:1671
Sequenced Size:1077

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2813 2001-01-01 Release 2 assignment
CG2813 2001-10-10 Blastp of sequenced clone
CG2813 2003-01-01 Sim4 clustering to Release 3
CG2813 2008-04-29 Release 5.5 accounting
CG2813 2008-08-15 Release 5.9 accounting
CG2813 2008-12-18 5.12 accounting

Clone Sequence Records

LD16147.complete Sequence

1077 bp (1077 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061213

> LD16147.complete
TTTTTTTGGGAGTGGTTTTGTTTGTTAATTTGACTTGTTTATTTACTTTG
AGCTTATCGGCTCCGATTGCGTTAATTACTCCAGATATACGATGAAATCG
TGGGAGATAGCTGTGGTGCTAGTCGCCGCTGTTTACTTGTGTTCGCAAGT
AAATTTCGTGGCCGGTCTGGAGTGCTATGTCTGCTCCAACCAGACGGGCA
ACACGGAGAAGTGCCTGAACACCATCAAGACCTGCGAGCCCTTTGAAAAC
GTCTGCGGAACGGAGATCCGCTGGGGATCCCAGCCGTACTTCTCGGAGGG
TGCTCTTAAGCAATACTACGTGTCCAAGAGGTGCATGACCAAGGAGCAGT
GCCAGTCCAAGAGGAAGCGCTATATGCAGCTGTACTGCACCCACATCTGG
TACGAGGATTGGGCGTGCAACGAGTGCTGCAAGGGAGATCGGTGCAACTA
CTTTGTCATTAGTGGCGCTCCTTCAAGACAAGGCTATGGTGTCTGTTTAA
CCCTGCTCACCGCACTATTAGGACTTGGATCTTGGCTCATTCCACGCTCT
TAGCCTCAAGAGCCTTTGCTATACCAAGCACATTTCGCTTTTTGTATTAT
TTAAACGAAGCCGTCCATAAGCTAAGTAGATTCCACACTCCATTTAAAAC
TACACCGTCAAAGTGCCTTGACTCAGTTGGGAAGTAATGCCATTTACTAT
CCTGATGCCTTGCGAAGCGAAGTTTCTTTTCTAATACTTTACATTTTATT
TGTAACAAAATTGTTTCTCTGGATTCAAGTTTTTTAGATTTTTTACGTTT
ATGGGACAGTTTTTATACTCGTGCATCAATGACAACAAGAGCTATTTTGA
TTATTGCTTTATTTCGAATTTTGCTGATGAATACGAATTGCATCCACGAC
ATATCCTAGACAAATTATCTAAGAGAAAGCTCAAACATGAACATTAAGCT
ACATATAAGAATCAAAAGAATGCCTTAAAAATAACAATCTGTTTCATATC
GAATCTCTCCCACAATAAAGCAACTTTGACGTCTTTTTGGCGCTTTAATA
TAAAAAAAAAAAAAAAAAAAAAAAAAA

LD16147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG2813-RA 1120 CG2813-RA 54..1105 1..1052 5260 100 Plus
CG2813.b 1118 CG2813.b 52..1107 1..1052 5195 99.6 Plus
CG2813.a 1048 CG2813.a 68..1037 83..1052 4850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 575148..575738 461..1051 2940 99.8 Plus
chr2L 23010047 chr2L 574782..575094 148..460 1565 100 Plus
chr2L 23010047 chr2L 574554..574702 1..149 745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:03:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 575144..575735 461..1052 2960 100 Plus
2L 23513712 2L 574778..575090 148..460 1565 100 Plus
2L 23513712 2L 574550..574698 1..149 745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 575144..575735 461..1052 2960 100 Plus
2L 23513712 2L 574778..575090 148..460 1565 100 Plus
2L 23513712 2L 574550..574698 1..149 745 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:21:52 has no hits.

LD16147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:22:49 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 574784..575094 150..460 100 -> Plus
chr2L 574554..574702 1..149 100 -> Plus
chr2L 575148..575738 461..1051 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:02 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
CG2813-RA 1..462 92..553 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:11 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
cold-RA 1..462 92..553 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:13 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
cold-RA 1..462 92..553 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:14:56 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
CG2813-RA 1..462 92..553 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:08 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
cold-RA 1..462 92..553 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:29:35 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
CG2813-RA 38..1088 1..1051 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:11 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
cold-RA 65..1115 1..1051 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:13 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
cold-RA 43..1093 1..1051 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:14:56 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
CG2813-RA 38..1088 1..1051 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:08 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
cold-RA 43..1093 1..1051 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:22:49 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575144..575734 461..1051 100   Plus
2L 574550..574698 1..149 100 -> Plus
2L 574780..575090 150..460 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:22:49 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575144..575734 461..1051 100   Plus
2L 574550..574698 1..149 100 -> Plus
2L 574780..575090 150..460 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:22:49 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575144..575734 461..1051 100   Plus
2L 574550..574698 1..149 100 -> Plus
2L 574780..575090 150..460 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:13 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 574550..574698 1..149 100 -> Plus
arm_2L 574780..575090 150..460 100 -> Plus
arm_2L 575144..575734 461..1051 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:51:44 Download gff for LD16147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 574780..575090 150..460 100 -> Plus
2L 575144..575734 461..1051 100   Plus
2L 574550..574698 1..149 100 -> Plus

LD16147.pep Sequence

Translation from 91 to 552

> LD16147.pep
MKSWEIAVVLVAAVYLCSQVNFVAGLECYVCSNQTGNTEKCLNTIKTCEP
FENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCT
HIWYEDWACNECCKGDRCNYFVISGAPSRQGYGVCLTLLTALLGLGSWLI
PRS*

LD16147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15025-PA 151 GF15025-PA 1..146 1..146 673 87 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24731-PA 150 GG24731-PA 1..150 1..153 761 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11235-PA 153 GH11235-PA 1..145 1..145 645 83.4 Plus
Dgri\GH11025-PA 153 GH11025-PA 1..145 1..145 645 83.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
cold-PB 153 CG2813-PB 1..153 1..153 857 100 Plus
cold-PA 153 CG2813-PA 1..153 1..153 857 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21798-PA 153 GI21798-PA 1..132 1..132 655 90.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18887-PA 153 GL18887-PA 1..153 1..153 690 90.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15471-PA 153 GA15471-PA 1..153 1..153 690 90.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16753-PA 153 GM16753-PA 1..153 1..153 806 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23035-PA 153 GD23035-PA 1..153 1..153 811 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17787-PA 153 GJ17787-PA 1..144 1..146 670 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24417-PA 155 GK24417-PA 2..129 1..128 623 91.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16935-PA 153 GE16935-PA 1..153 1..153 777 94.8 Plus

LD16147.hyp Sequence

Translation from 91 to 552

> LD16147.hyp
MKSWEIAVVLVAAVYLCSQVNFVAGLECYVCSNQTGNTEKCLNTIKTCEP
FENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCT
HIWYEDWACNECCKGDRCNYFVISGAPSRQGYGVCLTLLTALLGLGSWLI
PRS*

LD16147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
cold-PB 153 CG2813-PB 1..153 1..153 857 100 Plus
cold-PA 153 CG2813-PA 1..153 1..153 857 100 Plus