Clone LD16161 Report

Search the DGRC for LD16161

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:161
Well:61
Vector:pBS SK-
Associated Gene/TranscriptGas41-RA
Protein status:LD16161.pep: gold
Preliminary Size:965
Sequenced Size:787

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9207 2001-01-01 Release 2 assignment
CG9207 2003-01-01 Sim4 clustering to Release 3
CG9207 2003-01-13 Blastp of sequenced clone
Gas41 2008-04-29 Release 5.5 accounting
Gas41 2008-08-15 Release 5.9 accounting
Gas41 2008-12-18 5.12 accounting

Clone Sequence Records

LD16161.complete Sequence

787 bp (787 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061214

> LD16161.complete
AACTTAAAATCGTTGAATTATGACTGACTTTGGCGGAGACTCGGGTGGCC
GACTAAAGGGCGTAACTATAGTAAAGCCCATAGTGTATGGAAACATTGCC
AGATCCTTCGGCAAGAAGCGCGAGGAGGACGGACACACGCATCAGTGGAA
AGTCTATTTGAAGCCCTATTTCAACGAGGACATGTCCATTTACGTGAAAA
AGGTGCATTTCAAGCTGCACGAGAGCTACGCTAATCCGAACAGGATCGTA
GTTAAGCCGCCCTACGAGATTACCGAGACCGGATGGGGTGAATTCGAGGT
GATCATCAAGATATACTTCAACGATCAATCAGAGCGCCCGGTTACCTGCT
ACCACATCCTTAAGCTCTTCCAATCGCCTGTGGTCGATGGCGAGCTCTCC
TCTAGCACCACTATGGACACTAAGAAGGGCCTGGTCTCGGAGTCGTATGA
GGAAATAGTGTTCCAGGAGCCCACCCAGATCTTGCAGCATTATCTCCTGC
TTTCAGAACAGAGCGCCAATGGGTTGCTAACCCATGACACTGACTTTGAG
GAAAAGAAGACGAAAACGTTGGACAACATTGTGAATGTAAAACAGAAGGT
CAAGGGGGAGATTGTTACACTTAAGGACAAACTAAAGCTGGCACGTGAGA
CCATTTCGAAGTTCAAGGCAGAATTGGCGAAGGTGCAGAAGCAACCTGCG
TAAAATGTGCATAATTCTCTATAGAAATAATCTAAAAATTATTAATTAAA
TAAAATATTGGAAAATGTAAAAAAAAAAAAAAAAAAA

LD16161.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Gas41-RA 867 Gas41-RA 100..867 1..768 3840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6948675..6949219 545..1 2725 100 Minus
chr2L 23010047 chr2L 6948394..6948616 768..546 1115 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:03:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6949591..6950135 545..1 2725 100 Minus
2L 23513712 2L 6949309..6949532 769..546 1120 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6949591..6950135 545..1 2725 100 Minus
2L 23513712 2L 6949309..6949532 769..546 1120 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:20:53 has no hits.

LD16161.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:21:56 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6948438..6948616 546..724 100 <- Minus
chr2L 6948675..6949219 1..545 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:03 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..684 20..703 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:44 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..684 20..703 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:03 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..684 20..703 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:28 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..684 20..703 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:27:44 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..684 20..703 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:24 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..768 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:43 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..768 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:03 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 73..840 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:28 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 1..768 1..768 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:27:44 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
Gas41-RA 73..840 1..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:56 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6949310..6949532 546..768 100 <- Minus
2L 6949591..6950135 1..545 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:56 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6949310..6949532 546..768 100 <- Minus
2L 6949591..6950135 1..545 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:56 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6949310..6949532 546..768 100 <- Minus
2L 6949591..6950135 1..545 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:03 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6949310..6949532 546..768 100 <- Minus
arm_2L 6949591..6950135 1..545 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:59 Download gff for LD16161.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6949310..6949532 546..768 100 <- Minus
2L 6949591..6950135 1..545 100   Minus

LD16161.pep Sequence

Translation from 19 to 702

> LD16161.pep
MTDFGGDSGGRLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPY
FNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVIIKIYF
NDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQE
PTQILQHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKVKGEIVT
LKDKLKLARETISKFKAELAKVQKQPA*

LD16161.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14466-PA 227 GF14466-PA 1..227 1..227 1163 96 Plus
Dana\GF11507-PA 929 GF11507-PA 27..106 40..119 156 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23565-PA 228 GG23565-PA 1..228 1..227 1158 96.9 Plus
Dere\GG16912-PA 934 GG16912-PA 18..104 33..119 173 37.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11361-PA 227 GH11361-PA 1..227 1..227 1138 93.4 Plus
Dgri\GH18860-PA 958 GH18860-PA 25..90 40..105 159 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Gas41-PA 227 CG9207-PA 1..227 1..227 1180 100 Plus
ear-PC 931 CG4913-PC 27..106 40..119 165 38.8 Plus
ear-PA 931 CG4913-PA 27..106 40..119 165 38.8 Plus
ear-PB 945 CG4913-PB 27..106 40..119 165 38.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17738-PA 227 GI17738-PA 1..227 1..227 1111 91.2 Plus
Dmoj\GI22931-PA 955 GI22931-PA 23..90 38..105 155 38.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25598-PA 227 GL25598-PA 1..227 1..227 1158 93.8 Plus
Dper\GL12546-PA 475 GL12546-PA 27..92 40..105 162 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21613-PA 227 GA21613-PA 1..227 1..227 1158 93.8 Plus
Dpse\GA18521-PA 954 GA18521-PA 27..92 40..105 161 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13720-PA 227 GM13720-PA 1..227 1..227 1197 99.6 Plus
Dsec\GM24219-PA 942 GM24219-PA 27..106 40..119 170 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22526-PA 227 GD22526-PA 1..227 1..227 1193 99.1 Plus
Dsim\GD19009-PA 781 GD19009-PA 27..114 40..119 162 37.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17562-PA 227 GJ17562-PA 1..227 1..227 1122 93 Plus
Dvir\GJ23215-PA 966 GJ23215-PA 25..90 40..105 160 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24245-PA 248 GK24245-PA 1..198 1..198 1010 93.9 Plus
Dwil\GK11288-PA 971 GK11288-PA 25..92 38..105 160 39.7 Plus
Dwil\GK18381-PA 918 GK18381-PA 265..358 22..116 152 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18389-PA 227 GE18389-PA 1..227 1..227 1192 98.7 Plus
Dyak\GE24295-PA 939 GE24295-PA 27..106 40..119 168 38.8 Plus

LD16161.hyp Sequence

Translation from 19 to 702

> LD16161.hyp
MTDFGGDSGGRLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPY
FNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVIIKIYF
NDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQE
PTQILQHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKVKGEIVT
LKDKLKLARETISKFKAELAKVQKQPA*

LD16161.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Gas41-PA 227 CG9207-PA 1..227 1..227 1180 100 Plus
ear-PC 931 CG4913-PC 27..106 40..119 165 38.8 Plus
ear-PA 931 CG4913-PA 27..106 40..119 165 38.8 Plus
ear-PB 945 CG4913-PB 27..106 40..119 165 38.8 Plus