Clone LD16285 Report

Search the DGRC for LD16285

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:162
Well:85
Vector:pBS SK-
Associated Gene/Transcriptl(2)06496-RA
Protein status:LD16285.pep: gold
Preliminary Size:1303
Sequenced Size:1171

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9893 2001-01-01 Release 2 assignment
CG9893 2001-10-10 Blastp of sequenced clone
CG9893 2003-01-01 Sim4 clustering to Release 3
l(2)06496 2008-04-29 Release 5.5 accounting
l(2)06496 2008-08-15 Release 5.9 accounting
l(2)06496 2008-12-18 5.12 accounting

Clone Sequence Records

LD16285.complete Sequence

1171 bp (1171 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061216

> LD16285.complete
GTTTTGCAGACTGACATCATTCCCATCAAAACGAACAAAATAAAGAGAAA
TTCAGCGAAAAATGGAGGCACTGGACATTCTGGAGAAGCGCATCGATGCC
CTGACACGAGTCCTGGGTCCGGTCCAGGACTCTGAGGTGGGCGAGGGCGT
GGTCGACGCCCTGTGCTCGGCACACGCCATCCTGGGCGAAGCAACCACAG
GAAGTGCTGCACTGCAGCAGTGCGTGAAGAGATCTGACGAGCTGGAGAAG
TACCTGGACCCCAACTTCCTGGAGGAGCACCAGCAGGTGCGCTCCAAGGA
GGTGTACCTGCAAGCCGTGGCCCCCGAGCTGCACACGCAGGCCGAGCAGC
TGGAGAGGATTAAGCAGCTGGAACCGGCCCTGGGCGCGGAGTACTTCCGC
AGCATTCCCGCCGAGTGTCTGGAGCAGCTAAAGGGCATAACGCAGAACAA
CGGGGAGTACGCGCAGCAGAGCGAACTTATCGAGGAGAGTCTGGTCCTGG
CCATGAAGCGATATGGCGAGATCCAGGCGGGACTGCTGAGCTCCCTGGAT
GCCATGAGCGAGCGCTTGGACCAGGTAGAGGAGCGCATGGAGCAGAGGAA
GCGTGCAGAGTTGAGCAAGGATGTGCCGCCCAAGGATTGAGCGGATATAG
ATCCAAAGACTGCTGAAAGTATTTTATACGACCCCGTTTCCAAATCCGTT
CACCTGAAAATCTGGTTCCACTTAAGCTGAAGGCATCAGTTGCTCAAGCA
ATGGATGTAACCTAGGTTCTATTGAAAAGTGTAATCGTAGCTAAAGCCAT
CCCGATTTGATTGGAACTGTTTAAGGAAGCCGGGATATTAGATTTTCTAA
CTACTCCAACGTAAAGTGGCTAATGATGCTCTTTCAATTGTAAGTTTCAT
TTTTAAAAACTATTTAACTAAGCACAATAAACTAAATTACAAATCTAATG
AAAACCAATCAAAATCCTGTCTTACAGAAGGAAAATGCTATAATCACATA
ATAGAGCACAATATGGATTTATCATTGGCTGAATTTTATTTTTATTATCT
ATACAATGTATACAATACGATGTGACACTTATGTATGTAGGAATTGTAGA
AGGAAATAGTTACAAAATAATAATTTACCCGCGGAAACGCTCTTTCAACA
GTAAAAAAAAAAAAAAAAAAA

LD16285.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06496-RA 1183 l(2)06496-RA 32..1183 1..1152 5760 100 Plus
l(2)06496.a 1031 l(2)06496.a 32..768 1..737 3670 99.8 Plus
l(2)06496.a 1031 l(2)06496.a 857..1031 978..1152 875 100 Plus
CG30194-RB 2540 CG30194-RB 2406..2540 1155..1021 675 100 Minus
l(2)06496.a 1031 l(2)06496.a 756..856 789..889 490 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18947885..18949036 1152..1 5640 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23061417..23062571 1155..1 5775 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23062616..23063770 1155..1 5775 100 Minus
Blast to na_te.dros performed 2019-03-15 13:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 993..1062 899..967 130 70.4 Plus
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 465..580 1124..1019 124 62.1 Minus
Circe 7450 Circe CIRC 7450bp 3069..3168 923..1023 115 59.8 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6604..6685 1060..978 114 64.3 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 1356..1458 1129..1030 111 59.2 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9238..9340 1129..1030 111 59.2 Minus

LD16285.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:34:44 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18947885..18949036 1..1152 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:09 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 1..579 62..640 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:20 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 1..579 62..640 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:04:29 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 1..579 62..640 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:03 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 1..579 62..640 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:33:22 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 1..579 62..640 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:19 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 32..1183 1..1152 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:20 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 32..1183 1..1152 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:04:29 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 23..1174 1..1152 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:03 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 32..1183 1..1152 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:33:22 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06496-RA 23..1174 1..1152 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:44 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23061420..23062571 1..1152 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:44 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23061420..23062571 1..1152 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:44 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23061420..23062571 1..1152 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:04:29 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18948943..18950094 1..1152 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:00 Download gff for LD16285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23062637..23063788 1..1152 100   Minus

LD16285.pep Sequence

Translation from 61 to 639

> LD16285.pep
MEALDILEKRIDALTRVLGPVQDSEVGEGVVDALCSAHAILGEATTGSAA
LQQCVKRSDELEKYLDPNFLEEHQQVRSKEVYLQAVAPELHTQAEQLERI
KQLEPALGAEYFRSIPAECLEQLKGITQNNGEYAQQSELIEESLVLAMKR
YGEIQAGLLSSLDAMSERLDQVEERMEQRKRAELSKDVPPKD*

LD16285.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11306-PA 192 GF11306-PA 1..192 1..192 882 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\l(2)06496-PA 192 GG20074-PA 1..192 1..192 961 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20914-PA 200 GH20914-PA 1..200 1..192 798 77 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
DCTN3-p24-PB 192 CG9893-PB 1..192 1..192 954 100 Plus
DCTN3-p24-PA 192 CG9893-PA 1..192 1..192 954 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18349-PA 200 GI18349-PA 1..200 1..192 780 75.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10853-PA 192 GL10853-PA 1..192 1..192 848 82.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22106-PA 192 GA22106-PA 1..192 1..192 850 82.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15589-PA 192 GM15589-PA 1..192 1..192 950 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25087-PA 192 GD25087-PA 1..191 1..191 965 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20748-PA 202 GJ20748-PA 1..202 1..192 801 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19603-PA 196 GK19603-PA 1..196 1..192 795 79.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11612-PA 192 GE11612-PA 1..192 1..192 958 96.9 Plus

LD16285.hyp Sequence

Translation from 61 to 639

> LD16285.hyp
MEALDILEKRIDALTRVLGPVQDSEVGEGVVDALCSAHAILGEATTGSAA
LQQCVKRSDELEKYLDPNFLEEHQQVRSKEVYLQAVAPELHTQAEQLERI
KQLEPALGAEYFRSIPAECLEQLKGITQNNGEYAQQSELIEESLVLAMKR
YGEIQAGLLSSLDAMSERLDQVEERMEQRKRAELSKDVPPKD*

LD16285.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06496-PB 192 CG9893-PB 1..192 1..192 954 100 Plus
l(2)06496-PA 192 CG9893-PA 1..192 1..192 954 100 Plus