Clone LD16326 Report

Search the DGRC for LD16326

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:163
Well:26
Vector:pBS SK-
Associated Gene/TranscriptRpL19-RA
Protein status:LD16326.pep: gold
Preliminary Size:963
Sequenced Size:793

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2746 2001-01-01 Release 2 assignment
CG2746 2003-01-01 Sim4 clustering to Release 3
CG2746 2003-01-15 Blastp of sequenced clone
RpL19 2008-04-29 Release 5.5 accounting
RpL19 2008-08-15 Release 5.9 accounting
RpL19 2008-12-18 5.12 accounting

Clone Sequence Records

LD16326.complete Sequence

793 bp (793 high quality bases) assembled on 2003-01-15

GenBank Submission: AY061217

> LD16326.complete
CTGACTTCCGGCTGTCAAATTTTTCTTTCTTTCCTAGCCACGACGAGGTC
GACAGCATGAGTTCTCTAAAGCTCCAGAAGAGGCTCGCAGCCTCCGTGCT
GCGATGCGGCAAGAAGAAGGTCTGGTTGGATCCCAATGAAATCAACGAGA
TCGCTAACACAAACTCGCGTCAGAACATTCGCAAGCTTATCAAGGATGGT
CTGATCATCAAGAAGCCCGTCGTGGTCCACTCCCGTTACCGTGTGCGCAA
AAACACCGAGGCCCGCCGCAAGGGACGTCACTGCGGATTCGGAAAGCGTA
AGGGTACTGCGAACGCCCGCATGCCTACCAAGCTGCTGTGGATGCAGCGC
CAGCGCGTTCTGCGCCGCCTGTTGAAGAAGTACCGCGACAGCAAGAAGAT
TGACAGGCACCTGTACCACGACCTGTACATGAAGTGCAAGGGTAACGTAT
TCAAGAACAAGCGCGTCCTCATGGAGTACATCCACAAGAAGAAGGCTGAG
AAGCAGCGCAGCAAGATGCTGGCTGATCAGGCCGAGGCTCGCCGACAGAA
GGTGCGTGAGGCCCGCAAGCGCCGCGAGGAGCGTATTGCCACCAAGAAGC
AGGAGCTCATCGCCCTGCATGCTAAGGAGGACGAGATCGCTGCCAAGGCC
GCCACCGCGGGTCACTAAGCAGTCCGACCTCGCTAGTCGAGGAACTCCAT
ATTGATAGTACTGTTTATCGTCTGAATAAAACACCTTTAGTTTGGCCGAA
ATGATTTTGTACAAACGTGAAACTCAAAAAAAAAAAAAAAAAA

LD16326.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-RB 1349 RpL19-RB 135..910 1..776 3880 100 Plus
RpL19-RA 1349 RpL19-RA 135..910 1..776 3880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20854412..20855018 775..169 3020 99.8 Minus
chr2R 21145070 chr2R 20855083..20855193 170..60 555 100 Minus
chr2R 21145070 chr2R 20855436..20855496 61..1 305 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24968444..24969051 776..169 3040 100 Minus
2R 25286936 2R 24969116..24969226 170..60 555 100 Minus
2R 25286936 2R 24969469..24969529 61..1 305 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24969643..24970250 776..169 3040 100 Minus
2R 25260384 2R 24970315..24970425 170..60 555 100 Minus
2R 25260384 2R 24970668..24970728 61..1 305 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:19:36 has no hits.

LD16326.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:20:13 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20854412..20855018 169..775 99 <- Minus
chr2R 20855085..20855191 62..168 100 <- Minus
chr2R 20855436..20855496 1..61 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:12 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RB 1..612 57..668 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:31 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RB 1..612 57..668 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:01:01 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 1..612 57..668 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:25 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RB 1..612 57..668 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:07:13 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 1..612 57..668 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:16 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 19..793 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:31 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 19..793 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:01:01 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 19..793 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:25 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 19..793 1..775 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:07:13 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 19..793 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:20:13 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24968445..24969051 169..775 100 <- Minus
2R 24969118..24969224 62..168 100 <- Minus
2R 24969469..24969529 1..61 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:20:13 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24968445..24969051 169..775 100 <- Minus
2R 24969118..24969224 62..168 100 <- Minus
2R 24969469..24969529 1..61 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:20:13 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24968445..24969051 169..775 100 <- Minus
2R 24969118..24969224 62..168 100 <- Minus
2R 24969469..24969529 1..61 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:01:01 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20855968..20856574 169..775 100 <- Minus
arm_2R 20856641..20856747 62..168 100 <- Minus
arm_2R 20856992..20857052 1..61 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:41 Download gff for LD16326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24969662..24970268 169..775 100 <- Minus
2R 24970335..24970441 62..168 100 <- Minus
2R 24970686..24970746 1..61 100   Minus

LD16326.hyp Sequence

Translation from 2 to 667

> LD16326.hyp
DFRLSNFSFFPSHDEVDSMSSLKLQKRLAASVLRCGKKKVWLDPNEINEI
ANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRK
GTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVF
KNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQ
ELIALHAKEDEIAAKAATAGH*

LD16326.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-PB 203 CG2746-PB 1..203 19..221 1037 100 Plus
RpL19-PA 203 CG2746-PA 1..203 19..221 1037 100 Plus

LD16326.pep Sequence

Translation from 56 to 667

> LD16326.pep
MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLI
IKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQR
VLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQ
RSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDEIAAKAAT
AGH*

LD16326.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11517-PA 203 GF11517-PA 1..203 1..203 1051 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19869-PA 203 GG19869-PA 1..203 1..203 1051 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22044-PA 204 GH22044-PA 1..204 1..203 1023 97.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-PB 203 CG2746-PB 1..203 1..203 1037 100 Plus
RpL19-PA 203 CG2746-PA 1..203 1..203 1037 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19130-PA 203 GI19130-PA 1..203 1..203 1051 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10890-PA 203 GL10890-PA 1..203 1..203 1030 97.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15451-PA 203 GA15451-PA 1..203 1..203 1030 97.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11772-PA 203 GM11772-PA 1..203 1..203 1051 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24903-PA 203 GD24903-PA 1..203 1..203 1051 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22263-PA 203 GJ22263-PA 1..203 1..203 1051 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL19-PA 203 GE11393-PA 1..203 1..203 1048 99.5 Plus