Clone LD16402 Report

Search the DGRC for LD16402

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:164
Well:2
Vector:pBS SK-
Associated Gene/TranscriptProsbeta3-RA
Protein status:LD16402.pep: gold
Preliminary Size:1109
Sequenced Size:935

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11981 2001-01-01 Release 2 assignment
CG11981 2002-04-04 Blastp of sequenced clone
CG11981 2003-01-01 Sim4 clustering to Release 3
Prosbeta3 2008-04-29 Release 5.5 accounting
Prosbeta3 2008-08-15 Release 5.9 accounting
Prosbeta3 2008-12-18 5.12 accounting

Clone Sequence Records

LD16402.complete Sequence

935 bp (935 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095029

> LD16402.complete
TTCTATACAGCCAGTCAGTATTAGCCCATCTTACACTCGCAGTCTGGCAA
CGCAGAGCAGAAACAAAAAGTCATCTTCCCAGGCGGCTTTTAGCATTTTG
CAAAATTTCCATTTTTCTGCTGATTAAATTGAGCTAAGCGAATAGCAACG
ACACCATGTCGATTCTAGCCTACAACGGAGGATGTGTAGTGGCCATGCGC
GGAAAGGACTGCGTGGCGATTGCCACGGATCACCGATTCGGCATTCAGGC
TCAGACGATCTCCACGGACTTCAAGAAGGTGTTCCACATCGGCCCACGGA
TGTTCCTCGGGCTCACAGGCCTGCAGACGGACATCCTTACTGTTCGCGAT
CGCCTGATGTTCCGCAAGAATCTGTACGAGACACGCGAAAACCGTGAAAT
GTGTCCCAAGCCCTTCTCGGCCATGATGTCCAGCTTTCTGTACGAGCACC
GCTTTGGCCCGTACTTCATTGAGCCGGTCGTTGCTGGCCTGGATCCCAAG
ACCATGGAGCCTTTTATCTGCAACATGGACCTGATCGGCTGCCCCAACGC
ACCCGATGACTTCGTTGTGGCCGGCACCTGTGCGGAGCAATTGTATGGCA
TGTGCGAAACCCTGTGGAAACCCGATCTCGAGCCGGACCAGCTGTTTGAG
GTCATCGCCCAGTCCATTGTGAACGCATTCGATCGCGACGCCATGAGCGG
TTGGGGTGCCACCGTCTACATTATCGAGAAGGACAAGATCACGGAGCGCA
CACTGAAGACCCGCATGGACTAGATGATGTTAGAGGTTCCCTTGGTGATT
TTGTATACATTAACCGAAATACACATACAAATAAAATTTGTTTAGGTACA
ACATGTGCGTATTTCTTTTCCGTATAACGTAATAACACCAGAATTAAATG
CGTAATAACACCAGAAAAAAAAAAAAAAAAAAAAA

LD16402.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta3-RA 914 Prosbeta3-RA 1..914 1..914 4570 100 Plus
nc_15461.a 565 nc_15461.a 78..565 533..46 2440 100 Minus
nc_15461.a 565 nc_15461.a 1..82 657..576 410 100 Minus
CG11980-RA 1294 CG11980-RA 1221..1294 916..843 370 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4831207..4832120 914..1 4570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9005311..9006226 916..1 4580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8746142..8747057 916..1 4580 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:22:11 has no hits.

LD16402.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:23:03 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4831207..4832120 1..914 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:21 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..618 156..773 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:13:02 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..618 156..773 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:16:45 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..618 156..773 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:56:40 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..618 156..773 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:36 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..618 156..773 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:45:37 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:13:02 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:16:45 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:56:40 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:36 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta3-RA 1..914 1..914 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:23:03 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9005313..9006226 1..914 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:23:03 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9005313..9006226 1..914 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:23:03 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9005313..9006226 1..914 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:16:45 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4831035..4831948 1..914 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:29:08 Download gff for LD16402.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8746144..8747057 1..914 100   Minus

LD16402.hyp Sequence

Translation from 155 to 772

> LD16402.hyp
MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMF
LGLTGLQTDILTVRDRLMFRKNLYETRENREMCPKPFSAMMSSFLYEHRF
GPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDDFVVAGTCAEQLYGMC
ETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKITERTL
KTRMD*

LD16402.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta3-PA 205 CG11981-PA 1..205 1..205 1094 100 Plus
Prosbeta6-PA 235 CG4097-PA 28..235 7..205 197 28.9 Plus

LD16402.pep Sequence

Translation from 155 to 772

> LD16402.pep
MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMF
LGLTGLQTDILTVRDRLMFRKNLYETRENREMCPKPFSAMMSSFLYEHRF
GPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDDFVVAGTCAEQLYGMC
ETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKITERTL
KTRMD*

LD16402.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18436-PA 205 GF18436-PA 1..205 1..205 1053 93.7 Plus
Dana\GF10515-PA 235 GF10515-PA 28..235 7..205 217 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17403-PA 205 GG17403-PA 1..205 1..205 1107 100 Plus
Dere\GG15866-PA 235 GG15866-PA 28..235 7..205 192 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18224-PA 205 GH18224-PA 1..205 1..205 1064 94.1 Plus
Dgri\GH19348-PA 200 GH19348-PA 7..198 6..203 456 42.4 Plus
Dgri\GH16458-PA 235 GH16458-PA 28..235 7..205 237 30.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta3-PA 205 CG11981-PA 1..205 1..205 1094 100 Plus
Prosbeta6-PA 235 CG4097-PA 28..235 7..205 197 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10178-PA 205 GI10178-PA 1..205 1..205 1065 94.1 Plus
Dmoj\GI22558-PA 203 GI22558-PA 7..203 9..205 613 52.3 Plus
Dmoj\GI16713-PA 235 GI16713-PA 28..235 7..205 216 29.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12496-PA 205 GL12496-PA 1..205 1..205 1066 94.1 Plus
Dper\GL26359-PA 204 GL26359-PA 4..204 8..205 654 57.2 Plus
Dper\GL19755-PA 198 GL19755-PA 3..187 2..192 375 39.1 Plus
Dper\GL17976-PA 235 GL17976-PA 28..235 7..205 189 26.5 Plus
Dper\GL20944-PA 224 GL20944-PA 13..222 7..205 160 23.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11308-PA 205 GA11308-PA 1..205 1..205 1066 94.1 Plus
Dpse\GA28829-PA 204 GA28829-PA 4..204 8..205 659 57.7 Plus
Dpse\GA27033-PA 198 GA27033-PA 3..187 2..192 382 39.3 Plus
Dpse\GA17955-PA 235 GA17955-PA 28..235 7..205 189 26.5 Plus
Dpse\GA28639-PA 216 GA28639-PA 13..214 7..205 168 24.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26292-PA 205 GM26292-PA 1..205 1..205 1107 100 Plus
Dsec\GM19273-PA 82 GM19273-PA 1..82 124..205 432 98.8 Plus
Dsec\GM24382-PA 235 GM24382-PA 28..235 7..205 217 29.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20828-PA 205 GD20828-PA 1..205 1..205 1107 100 Plus
Dsim\GD12455-PA 235 GD12455-PA 28..235 7..205 217 29.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10880-PA 205 GJ10880-PA 1..205 1..205 1071 95.1 Plus
Dvir\GJ23747-PA 208 GJ23747-PA 7..208 4..205 755 60.4 Plus
Dvir\GJ12457-PA 235 GJ12457-PA 28..235 7..205 229 30.8 Plus
Dvir\GJ15696-PA 256 GJ15696-PA 48..256 7..205 177 27.9 Plus
Dvir\GJ15881-PA 262 GJ15881-PA 54..262 7..205 177 27.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11424-PA 205 GK11424-PA 1..205 1..205 1046 91.2 Plus
Dwil\GK20318-PA 233 GK20318-PA 26..233 7..205 199 28.4 Plus
Dwil\GK16137-PA 229 GK16137-PA 29..229 7..205 190 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24806-PA 205 GE24806-PA 1..205 1..205 1107 100 Plus
Dyak\GE22205-PA 235 GE22205-PA 28..235 7..205 212 28.9 Plus