Clone LD16419 Report

Search the DGRC for LD16419

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:164
Well:19
Vector:pBS SK-
Associated Gene/TranscriptRhoGDI-RA
Protein status:LD16419.pep: gold
Preliminary Size:1631
Sequenced Size:1494

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7823 2001-01-01 Release 2 assignment
CG7823 2001-10-10 Blastp of sequenced clone
CG7823 2003-01-01 Sim4 clustering to Release 3
RhoGDI 2008-04-29 Release 5.5 accounting
RhoGDI 2008-08-15 Release 5.9 accounting
RhoGDI 2008-12-18 5.12 accounting

Clone Sequence Records

LD16419.complete Sequence

1494 bp (1494 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061221

> LD16419.complete
AAAAGTTAGTTATCAAAAGTTGTTAAAAATATAACATACAGTTACTTTTC
AGTGATTAATTTTCAGAGATCGTACTATTTGATTAATTTCGCATATTAAA
AGTTCTAGGTTAGCAATCATGGCCGAAACAGAGACGAAGCACCATCCCGA
GCACCACGACGACGATGTCCACGATGCCAACTACCAGGCGCCGCCGGAGA
AGACCATCGAGGAAATAATGGCCGCCGATCAGGAGGATGAGAGCTTGCGG
CGCTACAAGGAGGCGCTCCTGGGTGCCGCCCAGACCGAGAAAATTATTGT
TGAACCCAATGATCCCCGAAAAGTTATTGTAAAGAAACTGGCCCTCGTTG
TCGAAGGACGCGACGACATGGAATTGGATCTTACCGGTGACCTTAGTCAG
CTGAAAAAGCAGCTTTTTGTGATCAAAGAAGGTGTTCAGTACAAGGTGCG
CATTGATTTTATTGTGCAGCGTGAAATAGTCCATGGCCTTAAGTATGTTC
AAAAGACTTCTCGCTTGGGTGTTAATGTTGACAAGATGAAGCATATGGTT
GGCTCCTATCCGCCGAAGAAGGAGATTCAGTTCTATTTGACGCCCGCCGA
GGAGGCACCTTCAGGCACATTCTCCCGCGGCACCTACTCGGTCAGTTCGG
TCTTCACGGATGACGACAAGCACATACACCTGGAGTGGGACTGGACCTTT
GAGATCAAAAAGGACTGGGCCTAATTGGCACACCGAACAGCACACAACAA
ACACACACGACACACAACTTACAACATACATCATACGCTTTTTGTTTTCC
CTCAAACATGCCTTGTAAATGAGTTTAGTTTTGTTCCAAAAGTGTAAGCG
AATTTTTCCAAAAGTGTAATTGATCGTCAAGTATTTTTGTTAACGGTATT
AAATTTTAAATATTTTTGTAACTAAAGTGTAATGTAAAGCCATGATAAGT
ATTTTTGATACCCTATTTGCAATTGGAATGTGTGCAGATGAAGAGCATTT
TTCGCCTAAGTCCTCCTCAATGAGAGTCAAGTCAAAACCAAGTCAAGTCA
CTAGGCCAGTCAGTCAGTCAGTCAGCCAACCAGTCAGTCAGACAGTCAGT
CGTTTGGTTCTTAATGCCATTGCCTATGTTTAACATACATTTTCAAACAG
ATTAACAATTGAGTAATTAACTTTAAGAAAGTTGTTTGCATTTCGCTGTG
TATTTCAAATTGAAGAATGGAATAGTTTATTGTAAGAACAAGTCGCCTCA
AAACTAAAAAGAAACCGATTAAAATCGTGCAACACGAACTGTTAAATGCA
ACTAAAGCTGATGCTTTATTATGCATTTGAAGTTTGTGCAACATGGAGTT
ACTTAAATCCACATTATTCTAACTATATATCTCTGTGTATTTTTTGTGTA
CAACATACCATATATGCGAAAGCTGATTGAATGCAACCGAAGAGCAATAA
AGAATAAAGGATACATATTTTAAAATAAAAAAAAAAAAAAAAAA

LD16419.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
RhoGDI-RA 1574 RhoGDI-RA 69..1547 1..1479 7395 100 Plus
RhoGDI.a 1568 RhoGDI.a 69..1541 1..1479 7280 99.5 Plus
RhoGDI.d 1614 RhoGDI.d 211..1587 103..1479 6885 100 Plus
RhoGDI.d 1614 RhoGDI.d 69..170 1..102 510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19921315..19922264 527..1476 4705 99.7 Plus
chr3L 24539361 chr3L 19920147..19920348 101..302 1010 100 Plus
chr3L 24539361 chr3L 19920594..19920715 410..531 595 99.2 Plus
chr3L 24539361 chr3L 19920421..19920531 302..412 555 100 Plus
chr3L 24539361 chr3L 19918137..19918238 1..102 510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19931981..19932933 527..1479 4765 100 Plus
3L 28110227 3L 19930813..19931014 101..302 1010 100 Plus
3L 28110227 3L 19931260..19931381 410..531 595 99.2 Plus
3L 28110227 3L 19931087..19931197 302..412 555 100 Plus
3L 28110227 3L 19928807..19928908 1..102 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19925081..19926033 527..1479 4765 100 Plus
3L 28103327 3L 19923913..19924114 101..302 1010 100 Plus
3L 28103327 3L 19924360..19924481 410..531 595 99.1 Plus
3L 28103327 3L 19924187..19924297 302..412 555 100 Plus
3L 28103327 3L 19921907..19922008 1..102 510 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:31:42 has no hits.

LD16419.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:32:36 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19918137..19918238 1..102 100 -> Plus
chr3L 19920149..19920348 103..302 100 -> Plus
chr3L 19920422..19920531 303..412 100 -> Plus
chr3L 19920597..19920711 413..527 100 -> Plus
chr3L 19921316..19922264 528..1476 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:23 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..606 119..724 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:16 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..606 119..724 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:54:09 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..606 119..724 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:15:00 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..606 119..724 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:06 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..606 119..724 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:29:41 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:16 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:09 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 65..1540 1..1476 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:15:00 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:06 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
RhoGDI-RA 65..1540 1..1476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:36 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19931088..19931197 303..412 100 -> Plus
3L 19931263..19931377 413..527 100 -> Plus
3L 19928807..19928908 1..102 100 -> Plus
3L 19930815..19931014 103..302 100 -> Plus
3L 19931982..19932930 528..1476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:36 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19931088..19931197 303..412 100 -> Plus
3L 19931263..19931377 413..527 100 -> Plus
3L 19928807..19928908 1..102 100 -> Plus
3L 19930815..19931014 103..302 100 -> Plus
3L 19931982..19932930 528..1476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:36 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19931088..19931197 303..412 100 -> Plus
3L 19931263..19931377 413..527 100 -> Plus
3L 19928807..19928908 1..102 100 -> Plus
3L 19930815..19931014 103..302 100 -> Plus
3L 19931982..19932930 528..1476 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:09 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19924188..19924297 303..412 100 -> Plus
arm_3L 19924363..19924477 413..527 100 -> Plus
arm_3L 19921907..19922008 1..102 100 -> Plus
arm_3L 19923915..19924114 103..302 100 -> Plus
arm_3L 19925082..19926030 528..1476 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:51:50 Download gff for LD16419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19925082..19926030 528..1476 100   Plus
3L 19921907..19922008 1..102 100 -> Plus
3L 19923915..19924114 103..302 100 -> Plus
3L 19924188..19924297 303..412 100 -> Plus
3L 19924363..19924477 413..527 100 -> Plus

LD16419.pep Sequence

Translation from 118 to 723

> LD16419.pep
MAETETKHHPEHHDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEAL
LGAAQTEKIIVEPNDPRKVIVKKLALVVEGRDDMELDLTGDLSQLKKQLF
VIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDKMKHMVGSYPPK
KEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW
A*

LD16419.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23606-PA 201 GF23606-PA 1..200 1..200 1028 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16070-PA 201 GG16070-PA 1..201 1..201 1034 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17059-PA 201 GH17059-PA 1..201 1..201 961 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
RhoGDI-PB 201 CG7823-PB 1..201 1..201 1054 100 Plus
RhoGDI-PA 201 CG7823-PA 1..201 1..201 1054 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11654-PA 201 GI11654-PA 1..201 1..201 958 90.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22671-PA 202 GL22671-PA 1..202 1..201 997 93.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20609-PA 202 GA20609-PA 1..202 1..201 991 93.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19691-PA 201 GM19691-PA 1..201 1..201 1051 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14840-PA 201 GD14840-PA 1..201 1..201 1059 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11334-PA 201 GJ11334-PA 1..201 1..201 953 90 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16712-PA 203 GK16712-PA 22..202 20..200 879 91.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19637-PA 201 GE19637-PA 1..201 1..201 1044 98 Plus
Dyak\GE23222-PA 168 GE23222-PA 1..168 34..201 868 98.2 Plus

LD16419.hyp Sequence

Translation from 118 to 723

> LD16419.hyp
MAETETKHHPEHHDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEAL
LGAAQTEKIIVEPNDPRKVIVKKLALVVEGRDDMELDLTGDLSQLKKQLF
VIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDKMKHMVGSYPPK
KEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW
A*

LD16419.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
RhoGDI-PB 201 CG7823-PB 1..201 1..201 1054 100 Plus
RhoGDI-PA 201 CG7823-PA 1..201 1..201 1054 100 Plus