Clone LD16456 Report

Search the DGRC for LD16456

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:164
Well:56
Vector:pBS SK-
Associated Gene/TranscriptNlp-RA
Protein status:LD16456.pep: gold
Preliminary Size:1272
Sequenced Size:1098

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7917 2001-01-01 Release 2 assignment
CG7917 2002-06-06 Blastp of sequenced clone
CG7917 2003-01-01 Sim4 clustering to Release 3
Nlp 2008-04-29 Release 5.5 accounting
Nlp 2008-08-15 Release 5.9 accounting
Nlp 2008-12-18 5.12 accounting

Clone Sequence Records

LD16456.complete Sequence

1098 bp (1098 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119592

> LD16456.complete
AAGACTTGAAATATTTTTTAATATATTTTACTGTCGCGTTAGCTTGCAAC
AAACGAATATAGATTGTCACATTCGATTGGACACTACAAGTGGCAGCCCT
GCGATTTTGATTCCCAGTCTGACAATCATCGATTTCGGCACCTTACGTCG
GCCTGGCAACCCTGCGACAGCTACCATTTTGCAAAAGATTTTGCTCAACA
CGTGTTCGCCGCTGGTTTTGTGTGGAATTAATATTAAATATTACCTACCA
TGGCTGAGGAATCATTCTACGGAGTCACTTTGACCGCCGAGAGCGACAGC
GTCACGTGGGATGTGGACGAGGACTACGCACGCGGCCAGAAGCTGGTCAT
CAAACAGATCCTCTTGGGCGCCGAGGCCAAGGAGAACGAGTTCAACGTGG
TCGAGGTGAACACACCCAAGGACTCCGTGCAAATTCCCATCGCCGTATTG
AAGGCCGGAGAGACCCGCGCCGTCAATCCCGACGTGGAGTTCTACGAGTC
GAAGGTGACATTCAAGCTGATCAAGGGCAGCGGACCCGTCTACATCCACG
GGCACAACATCAAGGACGATGTGGAGGTGGTCGACATGGAGGAGGATGAC
GAGGAGGATGATGTCGCCGAGGACGAGGAGGACGAGCACCCAAAGAAGCG
CGCCAAGATCGAGAACGCCGCCGATGGTAAAAATGCCAAGAACAACAAGA
AGAAGTAAACTGCTGACCGCCAATCATCCATCGAGGTTTAAGCTATGAAC
GTGTAGATTTTAAAGCAAAAACAGTTTTAGGCCCTATAATACAATACGAT
GCATACTGAGAATACAATCTAGTTCCTTTTGAACAGCTCCTTTTACATTC
AATTCAAAGACAACGTTGTGTGCTCGGTCGTGTTTCCCCAGCGAATGGTC
TGTCGCTCAGCCAGGAGTTCCGCACCCGGAAGCGGGAGCGGATCGGACTG
TGACTGATCCGGACACTAATCGAACACACAGATTTGTATATATATTAAAG
TATAACTAAAGCTAAGCCGGACTTCCTGTACGCGCCCCTTCATATTTGCA
GTATGAAAATAAACTTGTCGGAATACAAACAAAAAAAAAAAAAAAAAA

LD16456.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Nlp-RA 1109 Nlp-RA 22..1103 1..1082 5410 100 Plus
Nlp.a 1115 Nlp.a 69..1109 42..1082 5205 100 Plus
Nlp.b 744 Nlp.b 68..744 404..1080 3385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25832066..25832742 404..1080 3340 99.6 Plus
chr3R 27901430 chr3R 25827163..25827434 1..272 1360 100 Plus
chr3R 27901430 chr3R 25827669..25827807 271..409 695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30009676..30010354 404..1082 3395 100 Plus
3R 32079331 3R 30004785..30005056 1..272 1360 100 Plus
3R 32079331 3R 30005287..30005425 271..409 695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29750507..29751185 404..1082 3395 100 Plus
3R 31820162 3R 29745616..29745887 1..272 1360 100 Plus
3R 31820162 3R 29746118..29746256 271..409 695 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:48:25 has no hits.

LD16456.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:49:10 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25827196..25827433 34..271 100 -> Plus
chr3R 25827670..25827803 272..405 100 -> Plus
chr3R 25832068..25832224 406..562 99 == Plus
chr3R 25832299..25832742 637..1080 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:26 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..459 250..708 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:30:55 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..459 250..708 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:23 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..459 250..708 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:02 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..459 250..708 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:06 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..459 250..708 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:00:47 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..1080 1..1080 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:30:55 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..1080 1..1080 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:23 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..1080 1..1080 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:02 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..1080 1..1080 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:06 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
Nlp-RA 1..1080 1..1080 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:10 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30004785..30005055 1..271 100 -> Plus
3R 30005288..30005421 272..405 100 -> Plus
3R 30009678..30010352 406..1080 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:10 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30004785..30005055 1..271 100 -> Plus
3R 30005288..30005421 272..405 100 -> Plus
3R 30009678..30010352 406..1080 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:10 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30004785..30005055 1..271 100 -> Plus
3R 30005288..30005421 272..405 100 -> Plus
3R 30009678..30010352 406..1080 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:23 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25830507..25830777 1..271 100 -> Plus
arm_3R 25831010..25831143 272..405 100 -> Plus
arm_3R 25835400..25836074 406..1080 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:54:49 Download gff for LD16456.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29745616..29745886 1..271 100 -> Plus
3R 29746119..29746252 272..405 100 -> Plus
3R 29750509..29751183 406..1080 100   Plus

LD16456.hyp Sequence

Translation from 249 to 707

> LD16456.hyp
MAEESFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNV
VEVNTPKDSVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIH
GHNIKDDVEVVDMEEDDEEDDVAEDEEDEHPKKRAKIENAADGKNAKNNK
KK*

LD16456.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Nlp-PB 152 CG7917-PB 1..152 1..152 780 100 Plus
Nlp-PA 152 CG7917-PA 1..152 1..152 780 100 Plus
CG7911-PB 156 CG7911-PB 1..156 1..152 283 45.7 Plus
CG7911-PA 156 CG7911-PA 1..156 1..152 283 45.7 Plus

LD16456.pep Sequence

Translation from 249 to 707

> LD16456.pep
MAEESFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNV
VEVNTPKDSVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIH
GHNIKDDVEVVDMEEDDEEDDVAEDEEDEHPKKRAKIENAADGKNAKNNK
KK*

LD16456.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18816-PA 152 GF18816-PA 1..138 1..138 549 94.2 Plus
Dana\GF16212-PA 154 GF16212-PA 1..154 1..152 278 45 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11720-PA 152 GG11720-PA 1..152 1..152 777 100 Plus
Dere\GG11978-PA 156 GG11978-PA 1..111 1..101 261 52.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18574-PA 154 GH18574-PA 1..143 1..142 533 84 Plus
Dgri\GH22165-PA 152 GH22165-PA 1..108 1..101 250 50.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Nlp-PB 152 CG7917-PB 1..152 1..152 780 100 Plus
Nlp-PA 152 CG7917-PA 1..152 1..152 780 100 Plus
Nph-PB 156 CG7911-PB 1..156 1..152 283 45.7 Plus
Nph-PA 156 CG7911-PA 1..156 1..152 283 45.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10803-PA 153 GI10803-PA 1..153 1..152 562 82.5 Plus
Dmoj\GI21966-PA 156 GI21966-PA 1..156 1..152 286 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14018-PA 156 GL14018-PA 1..138 1..138 559 97.1 Plus
Dper\GL13489-PA 157 GL13489-PA 1..111 1..101 264 52.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20685-PA 156 GA20685-PA 1..138 1..138 559 97.1 Plus
Dpse\GA20679-PA 157 GA20679-PA 1..111 1..101 264 52.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12851-PA 152 GM12851-PA 1..152 1..152 777 100 Plus
Dsec\GM12196-PA 156 GM12196-PA 1..111 1..101 257 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21493-PA 152 GD21493-PA 1..152 1..152 777 100 Plus
Dsim\GD17477-PA 156 GD17477-PA 1..111 1..101 257 51.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14400-PA 154 GJ14400-PA 1..154 1..152 562 83.2 Plus
Dvir\GJ16333-PA 120 GJ16333-PA 8..114 6..111 307 53.3 Plus
Dvir\GJ14325-PA 156 GJ14325-PA 1..111 1..101 264 51.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13921-PA 153 GK13921-PA 1..142 1..143 540 85.3 Plus
Dwil\GK13375-PA 154 GK13375-PA 1..111 1..101 266 53.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10848-PA 152 GE10848-PA 1..152 1..152 773 99.3 Plus
Dyak\GE23428-PA 156 GE23428-PA 1..111 1..101 261 52.3 Plus