Clone LD16810 Report

Search the DGRC for LD16810

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:168
Well:10
Vector:pBS SK-
Associated Gene/Transcriptpim-RA
Protein status:LD16810.pep: gold
Preliminary Size:1089
Sequenced Size:900

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5052 2001-01-01 Release 2 assignment
CG5052 2001-10-10 Blastp of sequenced clone
CG5052 2003-01-01 Sim4 clustering to Release 3
pim 2008-04-29 Release 5.5 accounting
pim 2008-08-15 Release 5.9 accounting
pim 2008-12-18 5.12 accounting

Clone Sequence Records

LD16810.complete Sequence

900 bp (900 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061227

> LD16810.complete
CGCAGCTCACTGCTAGAATTCAATCAAAATACCTTTTTAACACCAATAAA
TGCTAACAAAATGGATCAGATTTTAAACAAGGAAAACACCGGCATTAATT
TGCCAGCGAATCCCATTAAAAATGGAGTTCCTACAAATTCCGTATTGAAG
AAACCTCTTGGTAACCTTGACAATGTGATGCACCAAACTCCTGGAATAAC
CCCGTTCAAAAGCACTTCTCTGAAACTCGAGGGTAGTATTGCCAAGCTTT
CGCTGCGAAAGGCCCCCAAACAAAATGTGGTCAGCAGGGATCGCGAGGAA
GTTAGGTATAAAACAAATAGCTGCTTTTTGGGCGCCTACGTATTGAATTG
CGAATACAGAGTCGTCAATTTGTTCAACTACACTGACTTTCCGAACGAGA
AATGTTTGAAGAACTGCAGCAAGCCGGTCACAGAGACCTGGTCGGAAAAT
CAAGAGGGCTATGAAGGACTATTGGATCAACTTTATCTTGATCTGCGCAC
ATTGGAAAATAATTTGGAAAACAGATGCCTTCCGCCCCTAGATTTTACTG
ACCTGCCATACATATACAACACAGAAAACATGGAGCCTGCAGAGCCTGAA
TACTTATTAAATTTATATCCCCCATTGCCTAACTTGGAAGGCATTGATGT
TCTATTTTAGATCCTTGTTTAAAAGTTCTATGATTAATTGTAGTTTAATA
TTTTTTAGCTAGGTATCTTTGTACTACTAATTAATTATTTATTAATGTTA
TGCTAAGAGAAACTGTTATACCATTAGCTATCCAAGTTTGTTGTCTCGAA
TCACATTTGTGAAAAATATTTTTTTTACGCTACAATATATTTAGTAGTTT
AAGAACCGACATTAAGCCTCCAACAGGCAATTAAAAAAAAAAAAAAAAAA

LD16810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
pim-RA 1088 pim-RA 98..980 1..883 4415 100 Plus
pim.a 1019 pim.a 179..961 101..883 3915 100 Plus
pim.a 1019 pim.a 63..162 1..100 500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10362452..10362909 425..882 2290 100 Plus
chr2L 23010047 chr2L 10362065..10362388 101..424 1620 100 Plus
chr2L 23010047 chr2L 10361902..10362001 1..100 500 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10363589..10364047 425..883 2295 100 Plus
2L 23513712 2L 10363202..10363525 101..424 1620 100 Plus
2L 23513712 2L 10363039..10363138 1..100 500 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10363589..10364047 425..883 2295 100 Plus
2L 23513712 2L 10363202..10363525 101..424 1620 100 Plus
2L 23513712 2L 10363039..10363138 1..100 500 100 Plus
Blast to na_te.dros performed 2019-03-16 16:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
NOF 4347 NOF FB 4347bp Derived from X51937 (g8297) (Rel. 44, Last updated, Version 6). 3870..3928 643..702 153 75 Plus
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 658..738 758..841 117 64 Plus

LD16810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:34:23 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10362065..10362388 101..424 100 -> Plus
chr2L 10361902..10362001 1..100 100 -> Plus
chr2L 10362452..10362909 425..882 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:41 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 1..600 61..660 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:57:48 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 1..600 61..660 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:51 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 1..600 61..660 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:40:50 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 1..600 61..660 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:33:34 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 1..600 61..660 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:12:03 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 63..944 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:57:48 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 51..932 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:51 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 51..932 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:40:50 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 63..944 1..882 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:33:34 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
pim-RA 51..932 1..882 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:34:23 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10363589..10364046 425..882 100   Plus
2L 10363039..10363138 1..100 100 -> Plus
2L 10363202..10363525 101..424 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:34:23 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10363589..10364046 425..882 100   Plus
2L 10363039..10363138 1..100 100 -> Plus
2L 10363202..10363525 101..424 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:34:23 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10363589..10364046 425..882 100   Plus
2L 10363039..10363138 1..100 100 -> Plus
2L 10363202..10363525 101..424 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:51 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10363039..10363138 1..100 100 -> Plus
arm_2L 10363202..10363525 101..424 100 -> Plus
arm_2L 10363589..10364046 425..882 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:23:57 Download gff for LD16810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10363202..10363525 101..424 100 -> Plus
2L 10363589..10364046 425..882 100   Plus
2L 10363039..10363138 1..100 100 -> Plus

LD16810.hyp Sequence

Translation from 0 to 659

> LD16810.hyp
RSSLLEFNQNTFLTPINANKMDQILNKENTGINLPANPIKNGVPTNSVLK
KPLGNLDNVMHQTPGITPFKSTSLKLEGSIAKLSLRKAPKQNVVSRDREE
VRYKTNSCFLGAYVLNCEYRVVNLFNYTDFPNEKCLKNCSKPVTETWSEN
QEGYEGLLDQLYLDLRTLENNLENRCLPPLDFTDLPYIYNTENMEPAEPE
YLLNLYPPLPNLEGIDVLF*

LD16810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
pim-PB 199 CG5052-PB 1..199 21..219 1064 100 Plus
pim-PA 199 CG5052-PA 1..199 21..219 1064 100 Plus

LD16810.pep Sequence

Translation from 60 to 659

> LD16810.pep
MDQILNKENTGINLPANPIKNGVPTNSVLKKPLGNLDNVMHQTPGITPFK
STSLKLEGSIAKLSLRKAPKQNVVSRDREEVRYKTNSCFLGAYVLNCEYR
VVNLFNYTDFPNEKCLKNCSKPVTETWSENQEGYEGLLDQLYLDLRTLEN
NLENRCLPPLDFTDLPYIYNTENMEPAEPEYLLNLYPPLPNLEGIDVLF*

LD16810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15772-PA 205 GF15772-PA 1..205 1..199 514 51.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\pim-PA 199 GG10115-PA 1..199 1..199 915 86.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
pim-PB 199 CG5052-PB 1..199 1..199 1064 100 Plus
pim-PA 199 CG5052-PA 1..199 1..199 1064 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10136-PA 222 GI10136-PA 1..172 1..149 158 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19150-PA 192 GL19150-PA 2..192 16..199 210 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\pim-PA 167 GA18622-PA 1..167 40..199 181 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18236-PA 199 GM18236-PA 1..199 1..199 976 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23684-PA 199 GD23684-PA 1..199 1..199 982 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23736-PA 521 GK23736-PA 6..172 5..188 165 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\pim-PA 199 GE18929-PA 1..199 1..199 913 86.4 Plus