Clone LD16949 Report

Search the DGRC for LD16949

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:169
Well:49
Vector:pBS SK-
Associated Gene/TranscriptaurA-RA
Protein status:LD16949.pep: gold
Preliminary Size:1636
Sequenced Size:1518

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3068 2001-01-01 Release 2 assignment
CG3068 2001-10-10 Blastp of sequenced clone
CG3068 2003-01-01 Sim4 clustering to Release 3
aur 2008-04-29 Release 5.5 accounting
aur 2008-08-15 Release 5.9 accounting
aur 2008-12-18 5.12 accounting

Clone Sequence Records

LD16949.complete Sequence

1518 bp (1518 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061229

> LD16949.complete
AGTCGTGAATGTTTTACCCAATATCGGCTTTCATTGTTAACTGACCAAAA
TTGTAATCTGTTCTGTTAGTTGTCGAGTGCCTGTGCCGTCATGTCCCATC
CGTCTGACCATGTGCTGCGTCCCAAGGAAAATGCTCCGCACAGAATGCCA
GAAAAATCAGCTGCAGTGCACAATATGCAAAAGAACTTGCTATTGGGAAA
GAAGCCCAACAGCGAGAATATGGCTCCAGCTAGCAAACCCTTGCCAGGAT
CCTCTGGCGCTTTGATCAGGAAGCCAGGCCTAGGAGGCTCCAATTCCATA
GCTTCCTCCGAAGGAAACAACTTCCAAAAACCCATGGTGCCGTCCGTGAA
GAAGACCACATCAGAGTTTGCTGCTCCGGCTCCAGTAGCACCTATCAAGA
AGCCTGAGTCACTTTCCAAGCAGAAACCCACTGCTGCGAGCTCTGAATCC
TCCAAGGAACTGGGTGCGGCCAGCAGCTCCGCTGAAAAAGAGAAAACCAA
GACTGAAACCCAGCCCCAGAAGCCGAAGAAGACCTGGGAGCTCAACAACT
TTGATATTGGTCGCCTGCTGGGACGGGGCAAGTTTGGCAACGTTTATTTG
GCGCGGGAAAAGGAATCCCAGTTCGTGGTGGCCCTAAAAGTGCTCTTTAA
GCGCCAGATTGGCGAGTCCAATGTGGAGCACCAGGTGCGTCGTGAGATCG
AGATACAATCGCACCTACGTCATCCGCATATCCTGCGTCTGTATGCCTAC
TTTCACGACGACGTGCGCATATATCTGATCTTGGAGTATGCGCCACAAGG
AACGCTTTTCAACGCCTTGCAGGCACAGCCGATGAAACGTTTCGATGAAC
GCCAGTCGGCCACCTATATTCAGGCGTTGTGCTCGGCGCTGCTCTATCTG
CATGAGCGGGACATCATACACAGGGACATCAAGCCGGAGAACTTGCTGCT
CGGGCACAAGGGCGTCCTGAAGATCGCCGACTTCGGTTGGTCCGTGCACG
AGCCGAACTCCATGCGCATGACACTGTGCGGCACTGTCGACTACTTGCCA
CCCGAAATGGTTCAGGGCAAGCCGCACACGAAAAACGTGGATCTATGGAG
CCTGGGTGTGCTCTGCTTTGAGCTGCTAGTGGGCCACGCTCCCTTCTACT
CGAAGAACTATGACGAGACCTACAAGAAGATTCTCAAGGTGGACTACAAA
CTGCCGGAGCACATTTCCAAGGCAGCATCCCATCTCATTTCCAAGCTGCT
GGTCCTTAATCCGCAGCACCGCCTACCGCTGGATCAGGTGATGGTGCATC
CTTGGATCCTGGCGCACACGCAGTGAACACATTCTTGTTTAATTTTCAGT
TAATTCCTTTTAATTACATTTTTAGTTTAGGGCTCCCCGCGTAATTTAAT
TATGGCATCATAAATTTTCATTTATATAGATACGAGAAATTAACATTTAT
CAATTAAGTTTATTATTATCATTAGCAATAAAGTTTGTGTGTGTTTTCGA
AAAAAAAAAAAAAAAAAA

LD16949.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
aur-RA 1691 aur-RA 167..1667 1..1501 7505 100 Plus
CG12213.a 2634 CG12213.a 2480..2634 1501..1347 775 100 Minus
CG12213-RB 2640 CG12213-RB 2486..2640 1501..1347 775 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7789239..7790233 505..1499 4975 100 Plus
chr3R 27901430 chr3R 7788875..7789177 203..505 1515 100 Plus
chr3R 27901430 chr3R 7788609..7788812 1..204 1020 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11963832..11964828 505..1501 4985 100 Plus
3R 32079331 3R 11963468..11963770 203..505 1515 100 Plus
3R 32079331 3R 11963202..11963405 1..204 1020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11704663..11705659 505..1501 4985 100 Plus
3R 31820162 3R 11704299..11704601 203..505 1515 100 Plus
3R 31820162 3R 11704033..11704236 1..204 1020 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:48:33 has no hits.

LD16949.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:49:13 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7788609..7788812 1..204 100 -> Plus
chr3R 7788877..7789177 205..505 100 -> Plus
chr3R 7789240..7790233 506..1499 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:51:44 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 1..1236 91..1326 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:08 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 1..1236 91..1326 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:28 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 1..1236 91..1326 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:14:54 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 1..1236 91..1326 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:15 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aurA-RA 1..1236 91..1326 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:29:31 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 73..1571 1..1499 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:08 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 73..1571 1..1499 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:28 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 79..1577 1..1499 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:14:54 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aur-RA 73..1571 1..1499 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:15 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
aurA-RA 79..1577 1..1499 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:13 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11963470..11963770 205..505 100 -> Plus
3R 11963202..11963405 1..204 100 -> Plus
3R 11963833..11964826 506..1499 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:13 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11963470..11963770 205..505 100 -> Plus
3R 11963202..11963405 1..204 100 -> Plus
3R 11963833..11964826 506..1499 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:13 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11963470..11963770 205..505 100 -> Plus
3R 11963202..11963405 1..204 100 -> Plus
3R 11963833..11964826 506..1499 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:28 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7788924..7789127 1..204 100 -> Plus
arm_3R 7789192..7789492 205..505 100 -> Plus
arm_3R 7789555..7790548 506..1499 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:51:41 Download gff for LD16949.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11704033..11704236 1..204 100 -> Plus
3R 11704301..11704601 205..505 100 -> Plus
3R 11704664..11705657 506..1499 100   Plus

LD16949.pep Sequence

Translation from 90 to 1325

> LD16949.pep
MSHPSDHVLRPKENAPHRMPEKSAAVHNMQKNLLLGKKPNSENMAPASKP
LPGSSGALIRKPGLGGSNSIASSEGNNFQKPMVPSVKKTTSEFAAPAPVA
PIKKPESLSKQKPTAASSESSKELGAASSSAEKEKTKTETQPQKPKKTWE
LNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVR
REIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKR
FDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGW
SVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHA
PFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQV
MVHPWILAHTQ*

LD16949.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17839-PA 404 GF17839-PA 1..404 1..411 1644 79.1 Plus
Dana\GF14057-PA 329 GF14057-PA 48..305 149..406 752 53.1 Plus
Dana\GF21982-PA 1480 GF21982-PA 130..392 144..407 474 36.1 Plus
Dana\GF10707-PA 770 GF10707-PA 11..267 151..406 472 37.3 Plus
Dana\GF23315-PA 356 GF23315-PA 38..286 145..394 439 36.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18531-PA 421 GG18531-PA 1..421 1..411 2040 91.4 Plus
Dere\GG10347-PA 329 GG10347-PA 48..307 149..408 735 51.9 Plus
Dere\GG13228-PA 766 GG13228-PA 11..268 151..407 488 38.3 Plus
Dere\GG12656-PA 1421 GG12656-PA 136..398 144..407 478 36.5 Plus
Dere\GG11917-PA 356 GG11917-PA 38..287 145..395 442 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23526-PA 398 GH23526-PA 1..398 1..411 1392 68.6 Plus
Dgri\GH13588-PA 331 GH13588-PA 48..305 149..406 739 52.7 Plus
Dgri\GH16744-PA 762 GH16744-PA 11..269 151..407 516 39 Plus
Dgri\GH24405-PA 1622 GH24405-PA 130..391 144..406 468 36.2 Plus
Dgri\GH14104-PA 357 GH14104-PA 38..287 145..395 445 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
aurA-PA 411 CG3068-PA 1..411 1..411 2149 100 Plus
aurB-PA 329 CG6620-PA 48..307 149..408 718 51.9 Plus
SAK-PA 769 CG7186-PA 11..268 151..407 480 38.3 Plus
Sik2-PA 1398 CG4290-PA 82..392 94..406 459 34.6 Plus
Pka-C3-PA 500 CG6117-PA 147..444 114..405 442 35.9 Plus
Pka-C3-PB 583 CG6117-PB 230..527 114..405 442 35.9 Plus
CG12069-PC 356 CG12069-PC 38..286 145..394 440 37.7 Plus
CG12069-PA 356 CG12069-PA 38..286 145..394 440 37.7 Plus
par-1-PH 993 CG8201-PH 301..627 65..406 429 31.3 Plus
KP78a-PB 705 CG6715-PB 45..355 94..411 425 33.3 Plus
KP78b-PB 604 CG17216-PB 63..314 154..406 416 38 Plus
KP78b-PA 604 CG17216-PA 63..314 154..406 416 38 Plus
par-1-PS 827 CG8201-PS 201..504 99..406 416 32.5 Plus
par-1-PW 832 CG8201-PW 201..504 99..406 416 32.5 Plus
par-1-PL 833 CG8201-PL 201..504 99..406 416 32.5 Plus
par-1-PA 938 CG8201-PA 201..504 99..406 416 32.5 Plus
par-1-PV 951 CG8201-PV 201..504 99..406 416 32.5 Plus
par-1-PX 1170 CG8201-PX 201..504 99..406 416 32.5 Plus
Pka-C1-PD 353 CG4379-PD 5..276 117..387 413 34.1 Plus
Pka-C1-PC 353 CG4379-PC 5..276 117..387 413 34.1 Plus
Pka-C1-PB 353 CG4379-PB 5..276 117..387 413 34.1 Plus
par-1-PR 1046 CG8201-PR 440..732 113..406 412 32.3 Plus
par-1-PT 1058 CG8201-PT 440..732 113..406 412 32.3 Plus
par-1-PP 1141 CG8201-PP 440..732 113..406 412 32.3 Plus
AMPKalpha-PC 582 CG3051-PC 24..279 150..405 411 33.3 Plus
AMPKalpha-PB 582 CG3051-PB 24..279 150..405 411 33.3 Plus
AMPKalpha-PA 582 CG3051-PA 24..279 150..405 411 33.3 Plus
CG43143-PD 1180 CG11870-PD 70..321 154..406 408 36.9 Plus
CG43143-PG 1199 CG43143-PG 70..321 154..406 408 36.9 Plus
CG43143-PB 1427 CG11870-PB 70..321 154..406 408 36.9 Plus
CG43143-PC 1427 CG11870-PC 70..321 154..406 408 36.9 Plus
CG43143-PA 1427 CG11870-PA 70..321 154..406 408 36.9 Plus
CG43143-PF 1532 CG43143-PF 70..321 154..406 408 36.9 Plus
CG43143-PH 1551 CG43143-PH 70..321 154..406 408 36.9 Plus
CG43143-PE 2537 CG43143-PE 70..321 154..406 408 36.9 Plus
CG43143-PI 2556 CG43143-PI 70..321 154..406 408 36.9 Plus
Sik3-PA 702 CG15072-PA 15..292 128..406 407 33.8 Plus
Sik3-PF 1379 CG42856-PF 15..292 128..406 407 33.8 Plus
Sik3-PE 1382 CG42856-PE 15..292 128..406 407 33.8 Plus
Sik3-PD 1468 CG42856-PD 15..292 128..406 407 33.8 Plus
Sik3-PC 1471 CG18604-PA 15..292 128..406 407 33.8 Plus
Sik3-PB 1471 CG15072-PB 15..292 128..406 407 33.8 Plus
CaMKI-PI 390 CG1495-PI 11..287 134..406 398 32 Plus
polo-PB 576 CG12306-PB 2..272 131..401 392 31.5 Plus
polo-PA 576 CG12306-PA 2..272 131..401 392 31.5 Plus
S6kII-PB 911 CG17596-PB 197..441 152..395 392 37.6 Plus
Akt1-PE 530 CG4006-PE 140..441 99..405 389 30.3 Plus
Akt1-PD 530 CG4006-PD 140..441 99..405 389 30.3 Plus
Akt1-PA 530 CG4006-PA 140..441 99..405 389 30.3 Plus
Akt1-PB 530 CG4006-PB 140..441 99..405 389 30.3 Plus
Akt1-PC 611 CG4006-PC 221..522 99..405 389 30.3 Plus
S6kII-PB 911 CG17596-PB 574..834 160..406 284 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23550-PA 366 GI23550-PA 3..366 29..411 1430 71.2 Plus
Dmoj\GI23560-PA 329 GI23560-PA 48..303 149..406 732 53.1 Plus
Dmoj\GI23549-PA 329 GI23549-PA 48..303 149..406 719 51.9 Plus
Dmoj\GI13469-PA 778 GI13469-PA 11..269 151..407 519 39.4 Plus
Dmoj\GI15425-PA 1432 GI15425-PA 134..395 144..406 469 36.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22255-PA 416 GL22255-PA 1..416 1..411 1645 77.4 Plus
Dper\GL19028-PA 329 GL19028-PA 48..305 149..406 741 52.7 Plus
Dper\GL11903-PA 777 GL11903-PA 11..268 151..406 503 38.4 Plus
Dper\GL15126-PA 1366 GL15126-PA 80..396 91..407 474 34.8 Plus
Dper\GL13993-PA 356 GL13993-PA 44..286 151..394 433 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15904-PA 416 GA15904-PA 1..416 1..411 1642 77.3 Plus
Dpse\GA19730-PA 329 GA19730-PA 48..305 149..406 742 52.7 Plus
Dpse\GA20166-PA 777 GA20166-PA 11..268 151..406 503 38.4 Plus
Dpse\GA18086-PA 1445 GA18086-PA 136..398 144..407 468 36.1 Plus
Dpse\GA11372-PA 356 GA11372-PA 44..286 151..394 435 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23989-PA 421 GM23989-PA 1..421 1..411 2111 94.5 Plus
Dsec\GM11336-PA 329 GM11336-PA 48..307 149..408 731 51.9 Plus
Dsec\GM22133-PA 769 GM22133-PA 11..268 151..407 490 37.8 Plus
Dsec\GM18924-PA 1329 GM18924-PA 135..397 144..407 478 36.5 Plus
Dsec\GM12138-PA 356 GM12138-PA 38..287 145..395 447 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18792-PA 421 GD18792-PA 1..421 1..411 2104 94.3 Plus
Dsim\GD22216-PA 329 GD22216-PA 48..307 149..408 731 51.9 Plus
Dsim\GD12112-PA 769 GD12112-PA 11..268 151..407 490 38.3 Plus
Dsim\GD16891-PA 356 GD16891-PA 38..287 145..395 447 37.5 Plus
Dsim\GD20665-PA 603 GD20665-PA 63..314 154..406 447 37.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23510-PA 363 GJ23510-PA 66..363 111..411 1437 86.7 Plus
Dvir\GJ20756-PA 331 GJ20756-PA 48..305 149..406 765 53.9 Plus
Dvir\GJ11832-PA 781 GJ11832-PA 3..269 145..407 532 39.7 Plus
Dvir\GJ16386-PA 1350 GJ16386-PA 56..372 72..407 472 32.5 Plus
Dvir\GJ23554-PA 1365 GJ23554-PA 69..320 154..406 451 36.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13515-PA 406 GK13515-PA 1..406 1..411 1542 72.3 Plus
Dwil\GK18371-PA 331 GK18371-PA 48..305 149..406 775 55 Plus
Dwil\GK17621-PA 787 GK17621-PA 11..268 151..406 505 38.8 Plus
Dwil\GK25743-PA 1437 GK25743-PA 159..421 144..407 484 36.1 Plus
Dwil\GK13114-PA 354 GK13114-PA 41..283 151..394 448 38.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26150-PA 417 GE26150-PA 1..417 1..411 1928 86.1 Plus
Dyak\GE13219-PA 329 GE13219-PA 48..307 149..408 722 51.2 Plus
Dyak\GE22325-PA 766 GE22325-PA 11..268 151..407 488 38.3 Plus
Dyak\GE16985-PA 1400 GE16985-PA 134..396 144..407 478 36.5 Plus
Dyak\GE23367-PA 356 GE23367-PA 44..287 151..395 442 37.7 Plus

LD16949.hyp Sequence

Translation from 90 to 1325

> LD16949.hyp
MSHPSDHVLRPKENAPHRMPEKSAAVHNMQKNLLLGKKPNSENMAPASKP
LPGSSGALIRKPGLGGSNSIASSEGNNFQKPMVPSVKKTTSEFAAPAPVA
PIKKPESLSKQKPTAASSESSKELGAASSSAEKEKTKTETQPQKPKKTWE
LNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVR
REIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKR
FDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGW
SVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHA
PFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQV
MVHPWILAHTQ*

LD16949.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
aurA-PA 411 CG3068-PA 1..411 1..411 2149 100 Plus
aurB-PA 329 CG6620-PA 48..307 149..408 718 51.9 Plus
SAK-PA 769 CG7186-PA 11..268 151..407 480 38.3 Plus
CG12069-PC 356 CG12069-PC 38..286 145..394 440 37.7 Plus
CG12069-PA 356 CG12069-PA 38..286 145..394 440 37.7 Plus