Clone LD17235 Report

Search the DGRC for LD17235

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:172
Well:35
Vector:pBS SK-
Associated Gene/TranscriptRpL11-RA
Protein status:LD17235.pep: gold
Preliminary Size:914
Sequenced Size:726

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7726 2001-01-01 Release 2 assignment
CG7726 2002-03-19 Blastp of sequenced clone
CG7726 2003-01-01 Sim4 clustering to Release 3
RpL11 2008-04-29 Release 5.5 accounting
RpL11 2008-08-15 Release 5.9 accounting
RpL11 2008-12-18 5.12 accounting

Clone Sequence Records

LD17235.complete Sequence

726 bp (726 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094790

> LD17235.complete
CGAGGGATACCTGTGAGCAGCTTTCACTCCTACATACCACAATGGCGGCG
GTTACCAAGAAGATTAAGCGCGATCCCGCGAAGAACCCGATGAGGGATCT
GCACATCCGCAAACTCTGCCTGAACATCTGCGTGGGCGAGTCCGGTGACA
GGCTGACCCGTGCCGCCAAGGTGCTGGAGCAGCTGACTGGTCAGCAGCCA
GTGTTCTCCAAGGCCCGCTACACGGTCCGTTCGTTCGGTATTCGCCGTAA
CGAGAAGATCGCTGTCCACTGCACGGTGCGCGGCGCCAAGGCTGAGGAGA
TTCTGGAGCGTGGCCTGAAGGTGCGCGAGTACGAGCTGCGTCGGGAGAAC
TTCTCCTCCACCGGCAACTTCGGTTTCGGCATCCAGGAACACATCGATCT
GGGCATCAAGTACGATCCCTCCATCGGTATCTATGGTCTGGACTTCTACG
TCGTCCTCGGCCGCCCTGGCTACAATGTGAACCACAGGAAGCGCAAGTCC
GGCACTGTCGGCTTCCAGCACCGCCTCACCAAGGAGGATGCCATGAAGTG
GTTCCAGCAGAAATACGATGGTATCATCTTGAACACCAAGAAGTAGAGGA
GCTCTATCAGTAACCATGTTTTTTAAGAAGAATTCTACAATAAACCTTGG
CTTGTGTCAACACGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

LD17235.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpL11.h 935 RpL11.h 105..727 47..669 3115 100 Plus
RpL11.d 733 RpL11.d 105..727 47..669 3115 100 Plus
RpL11.b 811 RpL11.b 184..805 48..669 3110 100 Plus
RpL11.b 811 RpL11.b 70..117 1..48 240 100 Plus
RpL11.h 935 RpL11.h 23..69 1..47 235 100 Plus
RpL11.d 733 RpL11.d 23..69 1..47 235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15329956..15330256 169..469 1505 100 Plus
chr2R 21145070 chr2R 15330470..15330667 468..665 990 100 Plus
chr2R 21145070 chr2R 15329774..15329899 47..172 630 100 Plus
chr2R 21145070 chr2R 15329600..15329647 1..48 240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:04:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19442799..19443099 169..469 1505 100 Plus
2R 25286936 2R 19443312..19443513 468..669 1010 100 Plus
2R 25286936 2R 19442617..19442742 47..172 630 100 Plus
2R 25286936 2R 19442443..19442490 1..48 240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19443998..19444298 169..469 1505 100 Plus
2R 25260384 2R 19444511..19444712 468..669 1010 100 Plus
2R 25260384 2R 19443816..19443941 47..172 630 100 Plus
2R 25260384 2R 19443642..19443689 1..48 240 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:32:54 has no hits.

LD17235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:34:03 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15329600..15329646 1..47 100 -> Plus
chr2R 15329775..15329897 48..170 100 -> Plus
chr2R 15329958..15330255 171..468 100 -> Plus
chr2R 15330471..15330667 469..665 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:06 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 1..555 42..596 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:29:00 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 1..555 42..596 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:54:27 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 1..555 42..596 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:14 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 1..555 42..596 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:31 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 1..555 42..596 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:55:26 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 30..694 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:29:00 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 30..694 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:27 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 37..701 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:03:14 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 30..694 1..665 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:31 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
RpL11-RA 37..701 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:03 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19442801..19443098 171..468 100 -> Plus
2R 19443313..19443509 469..665 100   Plus
2R 19442443..19442489 1..47 100 -> Plus
2R 19442618..19442740 48..170 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:03 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19442801..19443098 171..468 100 -> Plus
2R 19443313..19443509 469..665 100   Plus
2R 19442443..19442489 1..47 100 -> Plus
2R 19442618..19442740 48..170 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:03 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19442801..19443098 171..468 100 -> Plus
2R 19443313..19443509 469..665 100   Plus
2R 19442443..19442489 1..47 100 -> Plus
2R 19442618..19442740 48..170 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:27 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15329948..15329994 1..47 100 -> Plus
arm_2R 15330123..15330245 48..170 100 -> Plus
arm_2R 15330306..15330603 171..468 100 -> Plus
arm_2R 15330818..15331014 469..665 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:36:42 Download gff for LD17235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19444000..19444297 171..468 100 -> Plus
2R 19444512..19444708 469..665 100   Plus
2R 19443642..19443688 1..47 100 -> Plus
2R 19443817..19443939 48..170 100 -> Plus

LD17235.hyp Sequence

Translation from 2 to 595

> LD17235.hyp
RDTCEQLSLLHTTMAAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDR
LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEI
LERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYV
VLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTKK*

LD17235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
RpL11-PB 184 CG7726-PB 1..184 14..197 962 100 Plus
RpL11-PA 184 CG7726-PA 1..184 14..197 962 100 Plus

LD17235.pep Sequence

Translation from 41 to 595

> LD17235.pep
MAAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTG
QQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELR
RENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGYNVNHRK
RKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTKK*

LD17235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12342-PA 187 GF12342-PA 1..187 1..184 936 94.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21971-PA 184 GG21971-PA 1..184 1..184 980 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21683-PA 187 GH21683-PA 1..187 1..184 933 94.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpL11-PB 184 CG7726-PB 1..184 1..184 962 100 Plus
RpL11-PA 184 CG7726-PA 1..184 1..184 962 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18837-PA 187 GI18837-PA 1..187 1..184 942 95.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17744-PA 188 GL17744-PA 1..187 1..184 947 96.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27684-PA 188 GA27684-PA 1..187 1..184 947 96.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21960-PA 204 GM21960-PA 1..204 1..184 950 90.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11455-PA 184 GD11455-PA 1..184 1..184 980 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21865-PA 187 GJ21865-PA 1..187 1..184 945 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15870-PA 187 GK15870-PA 1..187 1..184 945 96.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12050-PA 184 GE12050-PA 1..184 1..184 980 100 Plus