Clone LD17368 Report

Search the DGRC for LD17368

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:173
Well:68
Vector:pBS SK-
Associated Gene/TranscriptOsi6-RA
Protein status:LD17368.pep: gold
Sequenced Size:1534

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Osi6 2008-04-29 Release 5.5 accounting
Osi6 2008-04-29 Picked prior to 5.5
Osi6 2008-08-15 Release 5.9 accounting
Osi6 2008-12-18 5.12 accounting

Clone Sequence Records

LD17368.complete Sequence

1534 bp assembled on 2007-11-15

GenBank Submission: BT031257

> LD17368.complete
ATTCGAATGAACACACCAGTGATTTCGGTGGTGCCAAAGGAATTCAGTCT
CAGAAATCACCAATCCACCAACCCAGCCACCAGCATGAAGTTCTTCGTTG
CCACCGCCTGCATCCTGCTCCTGGCAGCAGGTATCTCTGCCGATCCCGTC
AAGGCCGCTGAGGAGCAGCCCGGCGCCTTTGCCCAGTGCCTCGAGTCCGA
CTCCATCTCGTGCCTGCAGCTCACGCTCTTCCGCAAGGCCAAGTCCGTGT
TCGATAACCCTCAGATCGAGCTTTTCGGTGGTGTTTCTCTGGTGAAGTCC
AATGAAGGTCGTCAGGGCAAGTCCCTGGACAACTCCCTGGCTGTTGAGGC
CGCTCCCACCGTGGAGGCCCGCACCGCCGAGATGGGCAACTACTTCATGG
ACAACGCCAAGAGCTTCTTCGCTGAACGCTCCCTGAACTTCAACTTCGCT
AACGCCGCTCGCAGCGTGGCCCGCGCCATTCCCGATGACATCAAGGCTGA
TCTCCGCGAGCTGGTTGTTGAGTCCCGTACCCGCAAGAAGAAGCTGCTGA
AGAAGTTCCTGCCCATCCTGCTGGGAGTTGGTGCTAAGATCGCCGTCCTT
GGAGTCGGCTCCATCTTCGGACTACTGTTCCTGGCCAAGAAGGCACTGGT
TGTGTCTGTTATCGCCTTCTTCCTGGCTCTGGCTGCTGGTGCTTCCAGCG
GACTGGGACGCATCGGTGGATCCGGAGGCGGCGGCGGTCTGCTCGGCGGT
CTGGGAGGTCTCTTCGGCGGCAAGAACGCCGGTGGATCGTCGGCTGCCAG
CACCGGTGGATGGTCCTCGGGTGGTGGTGCCTCCAGCGCCGGATGGTCCT
CTGGCGGCAGCTCGGGTTGGGACACCCATGGTGCCTACAGCTCGCCTGTG
GCCCAGACCATCGCCTACCAGGGATACAAGCAGGCCCGCCGGTAAACAAT
TGGTCAAGAGCCAAATTAACCGAAGGACGAAGGCCAAGGAGAGAGAGAGA
AACAATCGCTAAAAATGATGACCTATATTTATATTTATTTATAAATTATT
TATTTTAATTTATTACTTGAACGAGAAGTACGAGACGAACAAAGTGCCTT
CCATTAGACAAAAAAACAATCACTTAATAACAAGACACACCCAAACACCA
AACACCACCTTTCATCCAGAACCGCCAATAACCTCCACAAAGGAATCTTT
ACTACTTTCCGCACTCCTCACTCTTCACGCTGTATCTCAATTTCATGGCT
GCACCTTTGATAAATGGACTGCAAATCTTTGCGACTAGTCGATCCATCAG
TCAAAGCCAGTCGCCTCGCCCATCTAACTGTATCTATCTCTCATCTGTTT
CCATCTATCTCTGTTCTACGACTATCTCTATCTGTACCTCTACCTTAATC
TATCTACCTATCTGTCTATCCATATCTGTCTGACTATCTGGACTTTCTCA
CTTTACCGCCCGGGAAAGACCAACCGAATGCTGCTAAATCAAAGAATCAA
ATAATAATTCAAACATAAAAAAAAAAAAAAAAAA

LD17368.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Osi6.b 2785 Osi6.b 80..1601 1..1522 7610 100 Plus
Osi6.a 2073 Osi6.a 80..1601 1..1522 7610 100 Plus
Osi6.c 2145 Osi6.c 622..2143 1..1522 7610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2061234..2062525 225..1516 6460 100 Plus
chr3R 27901430 chr3R 2060382..2060606 1..225 1125 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6235582..6236879 225..1522 6490 100 Plus
3R 32079331 3R 6234730..6234954 1..225 1125 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5976413..5977710 225..1522 6490 100 Plus
3R 31820162 3R 5975561..5975785 1..225 1125 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:35:20 has no hits.

LD17368.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:36:08 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2060382..2060606 1..225 100 -> Plus
chr3R 2061235..2062525 226..1516 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:10 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 1..939 7..945 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:04:16 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 1..939 7..945 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:49:27 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 1..939 7..945 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:50:16 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 1..939 7..945 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:57 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 1..939 7..945 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:55:51 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 22..1537 1..1516 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:04:16 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 22..1537 1..1516 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:49:27 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 23..1538 1..1516 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:50:17 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 22..1537 1..1516 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:57 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
Osi6-RA 23..1538 1..1516 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:08 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6234730..6234954 1..225 100 -> Plus
3R 6235583..6236873 226..1516 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:08 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6234730..6234954 1..225 100 -> Plus
3R 6235583..6236873 226..1516 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:08 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6234730..6234954 1..225 100 -> Plus
3R 6235583..6236873 226..1516 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:49:27 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2060452..2060676 1..225 100 -> Plus
arm_3R 2061305..2062595 226..1516 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:56:21 Download gff for LD17368.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5975561..5975785 1..225 100 -> Plus
3R 5976414..5977704 226..1516 100   Plus

LD17368.hyp Sequence

Translation from 0 to 944

> LD17368.hyp
IRMNTPVISVVPKEFSLRNHQSTNPATSMKFFVATACILLLAAGISADPV
KAAEEQPGAFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKS
NEGRQGKSLDNSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSLNFNFA
NAARSVARAIPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKIAVL
GVGSIFGLLFLAKKALVVSVIAFFLALAAGASSGLGRIGGSGGGGGLLGG
LGGLFGGKNAGGSSAASTGGWSSGGGASSAGWSSGGSSGWDTHGAYSSPV
AQTIAYQGYKQARR*

LD17368.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Osi6-PB 312 CG1151-PB 1..312 3..314 1562 100 Plus
Osi6-PA 312 CG1151-PA 1..312 3..314 1562 100 Plus
Osi14-PA 268 CG1155-PA 1..254 29..308 206 29 Plus
Osi12-PA 295 CG1154-PA 59..268 65..311 174 28.9 Plus
CG34327-PA 220 CG34327-PA 64..122 228..295 163 54.4 Plus

LD17368.pep Sequence

Translation from 6 to 944

> LD17368.pep
MNTPVISVVPKEFSLRNHQSTNPATSMKFFVATACILLLAAGISADPVKA
AEEQPGAFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSNE
GRQGKSLDNSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSLNFNFANA
ARSVARAIPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGV
GSIFGLLFLAKKALVVSVIAFFLALAAGASSGLGRIGGSGGGGGLLGGLG
GLFGGKNAGGSSAASTGGWSSGGGASSAGWSSGGSSGWDTHGAYSSPVAQ
TIAYQGYKQARR*

LD17368.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16378-PA 288 GF16378-PA 1..288 27..312 1382 95.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13147-PA 312 GG13147-PA 1..312 1..312 1577 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14022-PA 294 GH14022-PA 1..294 27..312 896 80.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Osi6-PB 312 CG1151-PB 1..312 1..312 1562 100 Plus
Osi6-PA 312 CG1151-PA 1..312 1..312 1562 100 Plus
Osi14-PA 268 CG1155-PA 1..254 27..306 206 29 Plus
Osi12-PA 295 CG1154-PA 59..268 63..309 174 28.9 Plus
CG34327-PA 220 CG34327-PA 64..122 226..293 163 54.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24394-PA 287 GI24394-PA 1..287 27..312 932 85.5 Plus
Dmoj\GI24403-PA 272 GI24403-PA 45..262 61..306 196 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24058-PA 288 GL24058-PA 1..288 27..312 949 94.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26494-PA 288 GA26494-PA 1..288 27..312 960 94.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10867-PA 286 GM10867-PA 1..286 27..312 1451 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19848-PA 312 GD19848-PA 1..312 1..312 1583 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14250-PA 290 GJ14250-PA 1..290 27..312 912 88 Plus
Dvir\GJ14261-PA 277 GJ14261-PA 1..233 27..263 164 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13036-PA 298 GK13036-PA 1..194 27..219 851 92.8 Plus
Dwil\GK22310-PA 273 GK22310-PA 1..167 27..219 692 77.8 Plus
Dwil\GK19328-PA 228 GK19328-PA 1..146 74..219 620 93.2 Plus
Dwil\GK21309-PA 103 GK21309-PA 1..103 27..128 475 86.4 Plus
Dwil\GK22848-PA 164 GK22848-PA 5..164 154..312 290 87.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10189-PA 312 GE10189-PA 1..312 1..312 1564 97.8 Plus