Clone LD17730 Report

Search the DGRC for LD17730

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:177
Well:30
Vector:pBS SK-
Associated Gene/TranscriptArfrp1-RA
Protein status:LD17730.pep: gold
Preliminary Size:1292
Sequenced Size:1074

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7039 2001-01-01 Release 2 assignment
CG7039 2001-10-10 Blastp of sequenced clone
CG7039 2003-01-01 Sim4 clustering to Release 3
CG7039 2008-04-29 Release 5.5 accounting
CG7039 2008-08-15 Release 5.9 accounting
CG7039 2008-12-18 5.12 accounting

Clone Sequence Records

LD17730.complete Sequence

1074 bp (1074 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061235

> LD17730.complete
TTTTGTTGGCCAAAAACACAATACAATGTACACATTGATGCACGGCTTCT
ACAAATACATGACTCAGAAGGACGACTACTGCGTGGTAATCCTGGGCCTG
GACAATGCTGGCAAAACGACTTACCTGGAGGCCGCCAAGACCACGTTTAC
GCGTAACTATAAGGGCCTCAATCCGAGCAAGATCACGACGACGGTGGGCC
TCAACATCGGCACCATCGACGTGCAGGGCGTACGCCTCAACTTCTGGGAT
CTTGGTGGCCAGCAGGAGCTGCAATCTCTCTGGGATAAGTACTACCAGGA
GTCGCATGGCGTCATCTACGTGATTGATTCCAACGACAGGGAGCGCATGG
AAGAGTCCAAAGCGATATTTGACAAGATGATCAAGAACGAACTGCTGTCC
GGAGTGCCTTTGCTAATCCTGGCCAACAAACAGGATCTGCCGGATGTGAT
GGGCGTGCGGGAGATCAAGCCAGTTTTCCAGCAGGCGGGTGCTTTAATCG
GGCGGCGAGATTGCCTCACCATTCCCGTATCCGCGCTGCACGGCGAGGGC
GTGGACGAGGGCATTAAGTGGCTGGTGGAGGCCATCAAACGACATGCGGT
GGTGCGGCCGCCGCGGGAAAACGATTAGAAGATCAAGCAGAAGACATCTG
GGCCTGGTAGTCGGCCCTCCACTGGCTTTAATTAGACATGTACTTTTGTA
AGTTAGGGGCTTAGGATAACGCTTATTTGTAATTAGCCAGACGAGATTGC
GAGATACCAATTGTAAAGATGCGTTGTCATTATTTGCAAAGACCTTTCTT
TTCGGTTAACTACTGCTGAGAAAATGAGGAAAACAATGTTAGAAAGCTGT
GAGACTTCTGCATAGGACAACGAATTACAAATACTATTGTTAGAATAACA
AAGAACGCAATGCTTATTAGCCAATTAAGTGCAAGAACTATAAATTCAGA
AGTACTTGAAGATGTATTTGAAGAAGTACTTTGTTCTGTTAATAACCCAG
ATACATGGGTATTTGGATGCCAAAAATGTAATAAAACTGAATCCATTCGC
AAAAAAAAAAAAAAAAAAAAAAAA

LD17730.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7039-RA 1362 CG7039-RA 167..1217 1..1051 5255 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8999470..9000149 371..1050 3385 99.9 Plus
chrX 22417052 chrX 8999099..8999352 118..371 1270 100 Plus
chrX 22417052 chrX 8998915..8999032 1..118 590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9107675..9108355 371..1051 3405 100 Plus
X 23542271 X 9107304..9107557 118..371 1270 100 Plus
X 23542271 X 9107120..9107237 1..118 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9115773..9116453 371..1051 3405 100 Plus
X 23527363 X 9115402..9115655 118..371 1270 100 Plus
X 23527363 X 9115218..9115335 1..118 590 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:23:25 has no hits.

LD17730.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:24:38 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8998915..8999032 1..118 100 -> Plus
chrX 8999100..8999352 119..371 100 -> Plus
chrX 8999471..9000149 372..1050 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:28 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 1..603 26..628 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:29 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 1..603 26..628 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:31 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 1..603 26..628 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:14 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 1..603 26..628 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:10 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
Arfrp1-RA 1..603 26..628 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:48 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 122..1171 1..1050 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:29 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 122..1171 1..1050 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:31 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 84..1133 1..1050 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:14 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
CG7039-RA 122..1171 1..1050 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:10 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
Arfrp1-RA 52..1101 1..1050 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:24:38 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
X 9107120..9107237 1..118 100 -> Plus
X 9107305..9107557 119..371 100 -> Plus
X 9107676..9108354 372..1050 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:24:38 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
X 9107120..9107237 1..118 100 -> Plus
X 9107305..9107557 119..371 100 -> Plus
X 9107676..9108354 372..1050 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:24:38 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
X 9107120..9107237 1..118 100 -> Plus
X 9107305..9107557 119..371 100 -> Plus
X 9107676..9108354 372..1050 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:31 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9001153..9001270 1..118 100 -> Plus
arm_X 9001338..9001590 119..371 100 -> Plus
arm_X 9001709..9002387 372..1050 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:12 Download gff for LD17730.complete
Subject Subject Range Query Range Percent Splice Strand
X 9115403..9115655 119..371 100 -> Plus
X 9115774..9116452 372..1050 100   Plus
X 9115218..9115335 1..118 100 -> Plus

LD17730.hyp Sequence

Translation from 0 to 627

> LD17730.hyp
FVGQKHNTMYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFT
RNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQE
SHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVM
GVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRHAV
VRPPREND*

LD17730.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Arfrp1-PA 200 CG7039-PA 1..200 9..208 1048 100 Plus
Arl2-PA 184 CG7435-PA 8..178 18..197 296 37 Plus
Arf79F-PJ 182 CG8385-PJ 1..178 9..196 276 33.7 Plus
Arf79F-PI 182 CG8385-PI 1..178 9..196 276 33.7 Plus
Arf79F-PH 182 CG8385-PH 1..178 9..196 276 33.7 Plus

LD17730.pep Sequence

Translation from 25 to 627

> LD17730.pep
MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNP
SKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVI
DSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREIKPV
FQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVRPPREND
*

LD17730.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19193-PA 200 GF19193-PA 1..200 1..200 1028 95.5 Plus
Dana\GF18345-PA 184 GF18345-PA 8..178 10..189 295 37 Plus
Dana\GF16955-PA 184 GF16955-PA 25..184 20..189 282 34.7 Plus
Dana\GF23441-PA 182 GF23441-PA 1..178 1..188 278 34 Plus
Dana\GF13030-PA 175 GF13030-PA 16..171 20..185 268 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18287-PA 200 GG18287-PA 1..200 1..200 1055 98.5 Plus
Dere\GG12548-PA 179 GG12548-PA 20..179 20..189 281 34.1 Plus
Dere\GG13164-PA 182 GG13164-PA 1..178 1..188 278 34 Plus
Dere\GG20511-PA 175 GG20511-PA 16..171 20..185 276 36.9 Plus
Dere\GG10035-PA 157 GG10035-PA 8..139 10..148 272 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12287-PA 200 GH12287-PA 1..200 1..200 1021 94.5 Plus
Dgri\GH14228-PA 184 GH14228-PA 8..179 10..190 296 36.8 Plus
Dgri\GH19902-PA 183 GH19902-PA 24..183 20..189 280 34.1 Plus
Dgri\GH14762-PA 182 GH14762-PA 1..178 1..188 278 34 Plus
Dgri\GH20425-PA 175 GH20425-PA 16..171 20..185 261 35.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
Arfrp1-PA 200 CG7039-PA 1..200 1..200 1048 100 Plus
Arl2-PA 184 CG7435-PA 8..178 10..189 296 37 Plus
Arf79F-PJ 182 CG8385-PJ 1..178 1..188 276 33.7 Plus
Arf79F-PI 182 CG8385-PI 1..178 1..188 276 33.7 Plus
Arf79F-PH 182 CG8385-PH 1..178 1..188 276 33.7 Plus
Arf79F-PF 182 CG8385-PF 1..178 1..188 276 33.7 Plus
Arf79F-PC 182 CG8385-PC 1..178 1..188 276 33.7 Plus
Arf79F-PE 182 CG8385-PE 1..178 1..188 276 33.7 Plus
Arf79F-PB 182 CG8385-PB 1..178 1..188 276 33.7 Plus
Arf79F-PA 182 CG8385-PA 1..178 1..188 276 33.7 Plus
Arf51F-PE 175 CG8156-PE 16..169 20..183 274 37.7 Plus
Arf51F-PA 175 CG8156-PA 16..169 20..183 274 37.7 Plus
Arf51F-PC 175 CG8156-PC 16..169 20..183 274 37.7 Plus
Arf51F-PB 175 CG8156-PB 16..169 20..183 274 37.7 Plus
Arf51F-PD 175 CG8156-PD 16..169 20..183 274 37.7 Plus
dnd-PA 179 CG6560-PA 20..179 20..189 274 34.7 Plus
Arl5-PA 179 CG7197-PA 11..177 12..188 258 36.3 Plus
Arf102F-PB 180 CG11027-PB 20..173 20..183 258 34.3 Plus
Arf102F-PA 180 CG11027-PA 20..173 20..183 258 34.3 Plus
Arl1-PA 180 CG6025-PA 19..177 20..188 249 34.5 Plus
Arl4-PA 312 CG2219-PA 27..152 20..148 241 43.9 Plus
Arl4-PB 313 CG2219-PB 28..153 20..148 241 43.9 Plus
Arl8-PC 186 CG7891-PC 11..182 8..188 218 25.4 Plus
Arl8-PB 186 CG7891-PB 11..182 8..188 218 25.4 Plus
Arl8-PA 186 CG7891-PA 11..182 8..188 218 25.4 Plus
Sar1-PE 193 CG7073-PE 23..192 20..187 213 32.6 Plus
Sar1-PC 193 CG7073-PC 23..192 20..187 213 32.6 Plus
Sar1-PD 193 CG7073-PD 23..192 20..187 213 32.6 Plus
Sar1-PA 193 CG7073-PA 23..192 20..187 213 32.6 Plus
CG17819-PA 186 CG17819-PA 22..184 19..190 206 28.9 Plus
Arl6-PA 202 CG7735-PA 14..184 14..188 204 29.1 Plus
Arl6-PB 201 CG7735-PB 14..183 14..188 202 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15532-PA 200 GI15532-PA 1..200 1..200 1017 94 Plus
Dmoj\GI24871-PA 184 GI24871-PA 8..179 10..190 305 37.9 Plus
Dmoj\GI22038-PA 437 GI22038-PA 278..437 20..189 284 34.1 Plus
Dmoj\GI11864-PA 182 GI11864-PA 1..178 1..188 278 34 Plus
Dmoj\GI19608-PA 175 GI19608-PA 16..171 20..185 267 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13091-PA 200 GL13091-PA 1..200 1..200 1022 95 Plus
Dper\GL23431-PA 184 GL23431-PA 8..178 10..189 300 36.5 Plus
Dper\GL23729-PA 182 GL23729-PA 23..182 20..189 286 34.7 Plus
Dper\GL25178-PA 182 GL25178-PA 1..178 1..188 278 34 Plus
Dper\GL17751-PA 175 GL17751-PA 16..171 20..185 275 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20052-PA 200 GA20052-PA 1..200 1..200 1026 95.5 Plus
Dpse\GA20349-PA 184 GA20349-PA 8..178 10..189 300 36.5 Plus
Dpse\GA19685-PA 182 GA19685-PA 23..182 20..189 286 34.7 Plus
Dpse\GA21036-PA 182 GA21036-PA 1..178 1..188 278 34 Plus
Dpse\GA20856-PA 175 GA20856-PA 16..171 20..185 275 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13718-PA 199 GM13718-PA 1..199 1..200 948 89.2 Plus
Dsec\GM23726-PA 184 GM23726-PA 8..178 10..189 298 37.6 Plus
Dsec\GM23682-PA 179 GM23682-PA 20..179 20..189 282 34.7 Plus
Dsec\GM22073-PA 182 GM22073-PA 1..178 1..188 278 34 Plus
Dsec\GM21603-PA 175 GM21603-PA 16..171 20..185 276 36.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24773-PA 200 GD24773-PA 1..200 1..200 1065 99.5 Plus
Dsim\GD18536-PA 184 GD18536-PA 8..178 10..189 299 37.6 Plus
Dsim\GD18491-PA 179 GD18491-PA 20..179 20..189 282 34.7 Plus
Dsim\GD12049-PA 182 GD12049-PA 1..178 1..188 278 34 Plus
Dsim\GD11108-PA 175 GD11108-PA 16..171 20..185 276 36.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14876-PA 200 GJ14876-PA 1..200 1..200 1020 94.5 Plus
Dvir\GJ24514-PA 184 GJ24514-PA 8..179 10..190 307 37.9 Plus
Dvir\GJ24091-PA 179 GJ24091-PA 20..179 20..189 281 34.1 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 1..178 1..188 278 34 Plus
Dvir\GJ14973-PA 175 GJ14973-PA 16..171 20..185 267 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25036-PA 200 GK25036-PA 1..200 1..200 1008 93 Plus
Dwil\GK13183-PA 184 GK13183-PA 8..178 10..189 302 36.5 Plus
Dwil\GK20496-PA 182 GK20496-PA 1..178 1..188 278 34 Plus
Dwil\GK13011-PA 193 GK13011-PA 34..193 20..189 276 34.3 Plus
Dwil\GK20891-PA 175 GK20891-PA 16..171 20..185 273 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15819-PA 200 GE15819-PA 1..200 1..200 1062 99.5 Plus
Dyak\GE25871-PA 184 GE25871-PA 8..178 10..189 292 36.5 Plus
Dyak\GE24074-PA 179 GE24074-PA 20..179 20..189 284 34.7 Plus
Dyak\GE19486-PA 182 GE19486-PA 1..178 1..188 278 34 Plus
Dyak\GE13644-PA 175 GE13644-PA 16..171 20..185 276 36.9 Plus