Clone LD17744 Report

Search the DGRC for LD17744

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:177
Well:44
Vector:pBS SK-
Associated Gene/TranscriptCG42557-RA
Protein status:LD17744.pep2: gold LD17744.pep: gold
Preliminary Size:1211
Sequenced Size:1090

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7866 2001-01-01 Release 2 assignment
CG7866 2001-11-29 Blastp of sequenced clone
CG7866 2003-01-01 Sim4 clustering to Release 3
CG7866 2008-04-29 Release 5.5 accounting
CG7866 2008-08-15 Release 5.9 accounting
CG7866 2008-12-18 5.12 accounting

Clone Sequence Records

LD17744.complete Sequence

1090 bp (1090 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069454.1

> LD17744.complete
TTTTTTGGATTTATGTAGGTTTATTTGGTTTTTAAAACATGTCACTTGGC
AATGCCGATCCCTGGCACTTGAAAAATACTATAGTTAAGCAAGGAATCTC
CGGGTCCGCGAATAATAGCGAAAGTTTTGAGGACAACTTCACGCCCTTGC
CCTCTGGAAACGAGAGCAACGTCCAAAAGGACGGGAAAATCGAGCCCCTT
CCGGATTCCAGCGACTATTTAAAGCTACTTGAGCGGAAGCTGGCCCGGGT
GCAGAAGGGCAACAAGTTGTTGGACAACCTGCGAGACAAGCGGCAGGATT
GCATGCGGGGATTGCTGTCTTCGGAGGGAGTGCCCATTTCCATTTTCGAG
CAGTTCCTTGAGCTAGACGCGCCCATCGAAAGCGGTCGCCTCCATCGGCA
CCTGCTGCCCGTTCAGGCCGTAAACGTGGGCGAAACTTTCCACATAGTGG
AGCACGACGCTCTGCAGCAGTCGGCAGAAGAAGCTCAGGAGGAGGAGTAG
GAGGATAAGCCCTCGGTTGAGCATTAACAAAATCACAATGGAATCCACGT
TCGGTAAAGTCTTCATGTTTCTCACGGACCTCGCTTGGAAAAGTCGTCTC
ACCATCCCTGTCATAGTCACAACTGCATTTCTCGTCATGGACATCCGCCT
GCAGATCGAGATCAACATTCAGTCCGGGCAATTTAATGCCAGCGATGTGG
ACGACGTTCAGGATGGCCTCGACGATCAGTTTAGGATGCACGATCACTGG
TCGGACGACGAAAGCGGCAGTGACATCTATACAGATGAGGAGTACACAAA
CGACGATGGCAACAGCGAAGCGTCCCACTACAGCGTGGACATCTACGATC
CCTGGGGGTCAGAAGACGAGGTAGACGCGAGCTATTCGCGAAGGATGCGG
TTCTAAGACACAATATAAATTCTACATAGGTGTAAGCGAGAGTAACTAGC
TTTATAGCTTATGTACATTCAGTAATGTCGAGCCCCTATTTATTCATCTC
AAACAGTCATATTAAACAAAGGTATTTAAGTGCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD17744.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42557-RA 1070 CG42557-RA 38..1070 1..1033 5165 100 Plus
CG42558-RA 1070 CG42558-RA 38..1070 1..1033 5165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25756066..25756519 231..684 2210 99.1 Plus
chr3R 27901430 chr3R 25756670..25757018 685..1033 1745 100 Plus
chr3R 27901430 chr3R 25755779..25756009 1..231 1155 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29933636..29934089 231..684 2270 100 Plus
3R 32079331 3R 29934239..29934589 685..1035 1755 100 Plus
3R 32079331 3R 29933349..29933579 1..231 1155 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29674467..29674920 231..684 2270 100 Plus
3R 31820162 3R 29675070..29675420 685..1035 1755 100 Plus
3R 31820162 3R 29674180..29674410 1..231 1155 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:24:38 has no hits.

LD17744.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:25:40 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25755779..25756009 1..231 100 -> Plus
chr3R 25756067..25756519 232..684 99 -> Plus
chr3R 25756670..25757018 685..1033 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:29 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG7866-RA 1..462 39..500 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:02 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42557-RA 1..462 39..500 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:02:20 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42557-RA 1..462 39..500 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:50:43 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG7866-RA 1..462 39..500 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:01:40 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42557-RA 1..462 39..500 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:59:25 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG7866-RA 38..1070 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:02 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42558-RA 38..1070 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:02:20 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42557-RA 63..1095 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:50:43 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG7866-RA 38..1070 1..1033 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:01:40 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42557-RA 63..1095 1..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:40 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29933349..29933579 1..231 100 -> Plus
3R 29933637..29934089 232..684 100 -> Plus
3R 29934239..29934587 685..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:40 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29933349..29933579 1..231 100 -> Plus
3R 29933637..29934089 232..684 100 -> Plus
3R 29934239..29934587 685..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:40 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29933349..29933579 1..231 100 -> Plus
3R 29933637..29934089 232..684 100 -> Plus
3R 29934239..29934587 685..1033 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:02:20 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25759071..25759301 1..231 100 -> Plus
arm_3R 25759359..25759811 232..684 100 -> Plus
arm_3R 25759961..25760309 685..1033 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:11 Download gff for LD17744.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29674180..29674410 1..231 100 -> Plus
3R 29674468..29674920 232..684 100 -> Plus
3R 29675070..29675418 685..1033 100   Plus

LD17744.hyp Sequence

Translation from 38 to 499

> LD17744.hyp
MSLGNADPWHLKNTIVKQGISGSANNSESFEDNFTPLPSGNESNVQKDGK
IEPLPDSSDYLKLLERKLARVQKGNKLLDNLRDKRQDCMRGLLSSEGVPI
SIFEQFLELDAPIESGRLHRHLLPVQAVNVGETFHIVEHDALQQSAEEAQ
EEE*

LD17744.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42557-PA 153 CG7866-PA 1..153 1..153 787 100 Plus

LD17744.pep Sequence

Translation from 38 to 499

> LD17744.pep
MSLGNADPWHLKNTIVKQGISGSANNSESFEDNFTPLPSGNESNVQKDGK
IEPLPDSSDYLKLLERKLARVQKGNKLLDNLRDKRQDCMRGLLSSEGVPI
SIFEQFLELDAPIESGRLHRHLLPVQAVNVGETFHIVEHDALQQSAEEAQ
EEE*

LD17744.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18808-PA 158 GF18808-PA 1..152 1..153 560 71.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11711-PA 161 GG11711-PA 1..153 1..153 759 94.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42557-PA 153 CG7866-PA 1..153 1..153 787 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10794-PA 174 GI10794-PA 1..155 1..140 426 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14008-PA 167 GL14008-PA 1..153 1..144 480 62.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20644-PA 167 GA20644-PA 1..153 1..144 480 62.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12841-PA 154 GM12841-PA 1..154 1..153 759 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21484-PA 154 GD21484-PA 1..154 1..153 753 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14391-PA 173 GJ14391-PA 1..152 1..142 438 57.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13199-PA 169 GK13199-PA 1..157 1..142 364 51.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23901-PA 161 GE23901-PA 1..153 1..153 752 94.8 Plus

LD17744.pep2 Sequence

Translation from 537 to 905

> LD17744.pep2
MESTFGKVFMFLTDLAWKSRLTIPVIVTTAFLVMDIRLQIEINIQSGQFN
ASDVDDVQDGLDDQFRMHDHWSDDESGSDIYTDEEYTNDDGNSEASHYSV
DIYDPWGSEDEVDASYSRRMRF*

LD17744.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18809-PA 132 GF18809-PA 1..132 1..122 394 70.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11712-PA 97 GG11712-PA 1..97 26..122 434 86.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18497-PA 138 GH18497-PA 1..114 1..109 302 57.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42558-PA 122 CG42558-PA 1..122 1..122 647 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10795-PA 132 GI10795-PA 2..132 1..122 335 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14009-PA 133 GL14009-PA 1..133 1..122 344 59.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26932-PA 133 GA26932-PA 1..133 1..122 344 59.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12842-PA 122 GM12842-PA 1..122 1..122 630 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21485-PA 122 GD21485-PA 1..122 1..122 630 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14392-PA 132 GJ14392-PA 1..132 1..122 341 57.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13200-PA 121 GK13200-PA 1..116 1..113 334 63 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23902-PA 122 GE23902-PA 1..122 1..122 576 88.5 Plus