BDGP Sequence Production Resources |
Search the DGRC for LD17744
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 177 |
Well: | 44 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG42557-RA |
Protein status: | LD17744.pep2: gold LD17744.pep: gold |
Preliminary Size: | 1211 |
Sequenced Size: | 1090 |
Gene | Date | Evidence |
---|---|---|
CG7866 | 2001-01-01 | Release 2 assignment |
CG7866 | 2001-11-29 | Blastp of sequenced clone |
CG7866 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7866 | 2008-04-29 | Release 5.5 accounting |
CG7866 | 2008-08-15 | Release 5.9 accounting |
CG7866 | 2008-12-18 | 5.12 accounting |
1090 bp (1090 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069454.1
> LD17744.complete TTTTTTGGATTTATGTAGGTTTATTTGGTTTTTAAAACATGTCACTTGGC AATGCCGATCCCTGGCACTTGAAAAATACTATAGTTAAGCAAGGAATCTC CGGGTCCGCGAATAATAGCGAAAGTTTTGAGGACAACTTCACGCCCTTGC CCTCTGGAAACGAGAGCAACGTCCAAAAGGACGGGAAAATCGAGCCCCTT CCGGATTCCAGCGACTATTTAAAGCTACTTGAGCGGAAGCTGGCCCGGGT GCAGAAGGGCAACAAGTTGTTGGACAACCTGCGAGACAAGCGGCAGGATT GCATGCGGGGATTGCTGTCTTCGGAGGGAGTGCCCATTTCCATTTTCGAG CAGTTCCTTGAGCTAGACGCGCCCATCGAAAGCGGTCGCCTCCATCGGCA CCTGCTGCCCGTTCAGGCCGTAAACGTGGGCGAAACTTTCCACATAGTGG AGCACGACGCTCTGCAGCAGTCGGCAGAAGAAGCTCAGGAGGAGGAGTAG GAGGATAAGCCCTCGGTTGAGCATTAACAAAATCACAATGGAATCCACGT TCGGTAAAGTCTTCATGTTTCTCACGGACCTCGCTTGGAAAAGTCGTCTC ACCATCCCTGTCATAGTCACAACTGCATTTCTCGTCATGGACATCCGCCT GCAGATCGAGATCAACATTCAGTCCGGGCAATTTAATGCCAGCGATGTGG ACGACGTTCAGGATGGCCTCGACGATCAGTTTAGGATGCACGATCACTGG TCGGACGACGAAAGCGGCAGTGACATCTATACAGATGAGGAGTACACAAA CGACGATGGCAACAGCGAAGCGTCCCACTACAGCGTGGACATCTACGATC CCTGGGGGTCAGAAGACGAGGTAGACGCGAGCTATTCGCGAAGGATGCGG TTCTAAGACACAATATAAATTCTACATAGGTGTAAGCGAGAGTAACTAGC TTTATAGCTTATGTACATTCAGTAATGTCGAGCCCCTATTTATTCATCTC AAACAGTCATATTAAACAAAGGTATTTAAGTGCAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25756066..25756519 | 231..684 | 2210 | 99.1 | Plus |
chr3R | 27901430 | chr3R | 25756670..25757018 | 685..1033 | 1745 | 100 | Plus |
chr3R | 27901430 | chr3R | 25755779..25756009 | 1..231 | 1155 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29933636..29934089 | 231..684 | 2270 | 100 | Plus |
3R | 32079331 | 3R | 29934239..29934589 | 685..1035 | 1755 | 100 | Plus |
3R | 32079331 | 3R | 29933349..29933579 | 1..231 | 1155 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29674467..29674920 | 231..684 | 2270 | 100 | Plus |
3R | 31820162 | 3R | 29675070..29675420 | 685..1035 | 1755 | 100 | Plus |
3R | 31820162 | 3R | 29674180..29674410 | 1..231 | 1155 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25755779..25756009 | 1..231 | 100 | -> | Plus |
chr3R | 25756067..25756519 | 232..684 | 99 | -> | Plus |
chr3R | 25756670..25757018 | 685..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7866-RA | 1..462 | 39..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42557-RA | 1..462 | 39..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42557-RA | 1..462 | 39..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7866-RA | 1..462 | 39..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42557-RA | 1..462 | 39..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7866-RA | 38..1070 | 1..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42558-RA | 38..1070 | 1..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42557-RA | 63..1095 | 1..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7866-RA | 38..1070 | 1..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42557-RA | 63..1095 | 1..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29933349..29933579 | 1..231 | 100 | -> | Plus |
3R | 29933637..29934089 | 232..684 | 100 | -> | Plus |
3R | 29934239..29934587 | 685..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29933349..29933579 | 1..231 | 100 | -> | Plus |
3R | 29933637..29934089 | 232..684 | 100 | -> | Plus |
3R | 29934239..29934587 | 685..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29933349..29933579 | 1..231 | 100 | -> | Plus |
3R | 29933637..29934089 | 232..684 | 100 | -> | Plus |
3R | 29934239..29934587 | 685..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25759071..25759301 | 1..231 | 100 | -> | Plus |
arm_3R | 25759359..25759811 | 232..684 | 100 | -> | Plus |
arm_3R | 25759961..25760309 | 685..1033 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29674180..29674410 | 1..231 | 100 | -> | Plus |
3R | 29674468..29674920 | 232..684 | 100 | -> | Plus |
3R | 29675070..29675418 | 685..1033 | 100 | Plus |
Translation from 38 to 499
> LD17744.hyp MSLGNADPWHLKNTIVKQGISGSANNSESFEDNFTPLPSGNESNVQKDGK IEPLPDSSDYLKLLERKLARVQKGNKLLDNLRDKRQDCMRGLLSSEGVPI SIFEQFLELDAPIESGRLHRHLLPVQAVNVGETFHIVEHDALQQSAEEAQ EEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42557-PA | 153 | CG7866-PA | 1..153 | 1..153 | 787 | 100 | Plus |
Translation from 38 to 499
> LD17744.pep MSLGNADPWHLKNTIVKQGISGSANNSESFEDNFTPLPSGNESNVQKDGK IEPLPDSSDYLKLLERKLARVQKGNKLLDNLRDKRQDCMRGLLSSEGVPI SIFEQFLELDAPIESGRLHRHLLPVQAVNVGETFHIVEHDALQQSAEEAQ EEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18808-PA | 158 | GF18808-PA | 1..152 | 1..153 | 560 | 71.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11711-PA | 161 | GG11711-PA | 1..153 | 1..153 | 759 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42557-PA | 153 | CG7866-PA | 1..153 | 1..153 | 787 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10794-PA | 174 | GI10794-PA | 1..155 | 1..140 | 426 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14008-PA | 167 | GL14008-PA | 1..153 | 1..144 | 480 | 62.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20644-PA | 167 | GA20644-PA | 1..153 | 1..144 | 480 | 62.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12841-PA | 154 | GM12841-PA | 1..154 | 1..153 | 759 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21484-PA | 154 | GD21484-PA | 1..154 | 1..153 | 753 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14391-PA | 173 | GJ14391-PA | 1..152 | 1..142 | 438 | 57.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13199-PA | 169 | GK13199-PA | 1..157 | 1..142 | 364 | 51.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23901-PA | 161 | GE23901-PA | 1..153 | 1..153 | 752 | 94.8 | Plus |
Translation from 537 to 905
> LD17744.pep2 MESTFGKVFMFLTDLAWKSRLTIPVIVTTAFLVMDIRLQIEINIQSGQFN ASDVDDVQDGLDDQFRMHDHWSDDESGSDIYTDEEYTNDDGNSEASHYSV DIYDPWGSEDEVDASYSRRMRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18809-PA | 132 | GF18809-PA | 1..132 | 1..122 | 394 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11712-PA | 97 | GG11712-PA | 1..97 | 26..122 | 434 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18497-PA | 138 | GH18497-PA | 1..114 | 1..109 | 302 | 57.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42558-PA | 122 | CG42558-PA | 1..122 | 1..122 | 647 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10795-PA | 132 | GI10795-PA | 2..132 | 1..122 | 335 | 56.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14009-PA | 133 | GL14009-PA | 1..133 | 1..122 | 344 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26932-PA | 133 | GA26932-PA | 1..133 | 1..122 | 344 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12842-PA | 122 | GM12842-PA | 1..122 | 1..122 | 630 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21485-PA | 122 | GD21485-PA | 1..122 | 1..122 | 630 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14392-PA | 132 | GJ14392-PA | 1..132 | 1..122 | 341 | 57.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13200-PA | 121 | GK13200-PA | 1..116 | 1..113 | 334 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23902-PA | 122 | GE23902-PA | 1..122 | 1..122 | 576 | 88.5 | Plus |