Clone LD17911 Report

Search the DGRC for LD17911

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:179
Well:11
Vector:pBS SK-
Associated Gene/TranscriptCG3457-RA
Protein status:LD17911.pep: gold
Preliminary Size:1043
Sequenced Size:858

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3457 2001-10-10 Blastp of sequenced clone
CG3457 2003-01-01 Sim4 clustering to Release 3
CG3457 2008-04-29 Release 5.5 accounting
CG3457 2008-08-15 Release 5.9 accounting
CG3457 2008-12-18 5.12 accounting

Clone Sequence Records

LD17911.complete Sequence

858 bp (858 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061236

> LD17911.complete
GCAAAAATCAGGAATTCGACTTCGAGATGCTGAAGCGCGATCTGCAGAAA
ATCACACTCAAGCTGTCCGATCTCAAGGACTATGAGGTTGCCCGCCAAAA
GAACAAGTTAAAGGGCGCCCCGCGACCTAGGCTTTCTCAGGACGCCCTCC
CCGGAGACGACGCCTCCACTTCGGGAACAACGGCAAGTTGCAGTTCCAAC
ACGGAAACGGCCACGGAAACCGCATCGGGATCCGGATCAGGGTCTGGATC
GGGCTCGGGTTCTGGGTCCGGGTCGTACATTACGGGAATGGGCTACCGTT
CGGAGACACCCTCCTCCGCATCGTACACCACGTCGACGACCCCGACTCCG
GCCACTCAGGAGGAGATACTGAGACCCTCGTCCGCCGTCACGGCCACCAC
AACCACTGGCACCACTAATTCCGGCTCCACGGATGACGTGAGCGTGGCGG
CCGTAGTGGATGACACGGATACCATTGACGAAATCAGCGATGACAACTGG
GTGGACCTGAATGCGGACACCAACGATACCGTTGATACCCAGCCGGAGGA
GCAGGACCAACTGCAAGAGGTGGAGGAGGAGGATGGGGCTAGGGGAGGAG
TGTAATCCTGACCGCTTATCGCGTTATGAAAACATAGCGCAGCTGCACTC
AAAGCCCACCCCCCCCCCCCCCATTTCACATTCCATTTATCATAACAATT
TGTATACGTAAACAAGTATAATAACCCATTGCATGCTCCACTTACCTAGC
TGCTAATAATAATAGTTTGCAAGGTTATATGTCGCTTATGTCATCTTCAA
ATCGAAACATATGCATTTTATAGATTTGGTTAACTACGGTAAAAAAAAAA
AAAAAAAA

LD17911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3457-RA 894 CG3457-RA 50..892 1..843 4215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2081803..2082642 1..840 4200 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2187871..2188713 1..843 4215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2195969..2196811 1..843 4215 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:52:29 has no hits.

LD17911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:54:21 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2081803..2082642 1..840 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:31 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:19 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:44:32 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:01 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:40 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:18 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 50..889 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:19 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 50..889 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:32 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 52..891 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:01 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 50..889 1..840 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:40 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
CG3457-RA 52..891 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:21 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
X 2187871..2188710 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:21 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
X 2187871..2188710 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:21 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
X 2187871..2188710 1..840 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:32 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2081904..2082743 1..840 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:59 Download gff for LD17911.complete
Subject Subject Range Query Range Percent Splice Strand
X 2195969..2196808 1..840 100   Plus

LD17911.hyp Sequence

Translation from 2 to 604

> LD17911.hyp
KNQEFDFEMLKRDLQKITLKLSDLKDYEVARQKNKLKGAPRPRLSQDALP
GDDASTSGTTASCSSNTETATETASGSGSGSGSGSGSGSGSYITGMGYRS
ETPSSASYTTSTTPTPATQEEILRPSSAVTATTTTGTTNSGSTDDVSVAA
VVDDTDTIDEISDDNWVDLNADTNDTVDTQPEEQDQLQEVEEEDGARGGV
*

LD17911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3457-PB 192 CG3457-PB 1..192 9..200 970 100 Plus
CG3457-PA 192 CG3457-PA 1..192 9..200 970 100 Plus

LD17911.pep Sequence

Translation from 26 to 604

> LD17911.pep
MLKRDLQKITLKLSDLKDYEVARQKNKLKGAPRPRLSQDALPGDDASTSG
TTASCSSNTETATETASGSGSGSGSGSGSGSGSYITGMGYRSETPSSASY
TTSTTPTPATQEEILRPSSAVTATTTTGTTNSGSTDDVSVAAVVDDTDTI
DEISDDNWVDLNADTNDTVDTQPEEQDQLQEVEEEDGARGGV*

LD17911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22202-PA 201 GF22202-PA 1..166 1..171 427 71.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12919-PA 198 GG12919-PA 1..197 1..191 605 87.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12441-PA 130 GH12441-PA 1..128 1..191 194 36.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG3457-PB 192 CG3457-PB 1..192 1..192 970 100 Plus
CG3457-PA 192 CG3457-PA 1..192 1..192 970 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13328-PA 150 GL13328-PA 1..149 1..191 280 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17463-PA 150 GA17463-PA 1..149 1..191 284 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19210-PA 192 GM19210-PA 1..192 1..192 946 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16966-PA 128 GJ16966-PA 1..126 1..191 226 39.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16060-PA 184 GK16060-PA 1..181 1..191 174 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16247-PA 201 GE16247-PA 1..185 1..179 586 89.2 Plus