Clone LD17963 Report

Search the DGRC for LD17963

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:179
Well:63
Vector:pBS SK-
Associated Gene/TranscriptCG40196-RB
Protein status:LD17963.pep: validated full length
Sequenced Size:1062

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG40196 2004-03-31 Blastp of sequenced clone
CG40196 2008-04-29 Release 5.5 accounting

Clone Sequence Records

LD17963.complete Sequence

1062 bp (1062 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012488

> LD17963.complete
ATTTCACGGAAGGCGAATATACATTTATTTTTTAAGGATCAGCAAAGGAT
AGCAAACGCAAGAACGATGCTCAGACTTTTTAAATCGGAGCGAATGCTAG
CTTGCCTGTTTTATATGCAAATACTTCAAGGAAGATATATTATAAATCAA
CAAAACTTGATAAGACACAATTCTGCGTAATTCTATATATTGTAACGCTA
TCGATGACTTAAATTTATATGTATCATTTAAATTTAATTTATAAATCATG
AAGTTACTTGAAAGTTCACGTTTTGAGGCTATCAACAACGCTCTTTCTAT
ACAAACAAGTGGCATCACGATTTTTGGACGGATAGAAAGTTACTCATGCA
AAATGGTTGCGGCCGAGAAAGTATTGTATAAACGATTTACAGCAGATTCT
CATGGGCATGACCTTCAGGCGTTATCACCTCCACAAACTTTGGCTGACTT
TTCACCAAACTTTCGTCGAAACAACAGTCAATCTGGAGATGAAGGCATTA
CTCTTTGCGATACCATTTCCAGAAAAACATTATTTTATTTAATTGCTACT
TTAAATGCGTCTTTTGAACCAGACTACGATTTTTCTGAAGCAAAGTCCCA
TGAATTTAGCAAAGAGCCGTCATTGCAGTGGGTTATGAACTCAATCCATG
CAAATTTATCGGCATTAGCGGGAGATCAGTATCAAGCTATACGTCAACCA
TTATGGTCTGCAGTTGACGACGAAGTGATCCTATCAGAGTGTGACATATA
CAGTTATAATCCAGATCTAAGTTGCGATCCTTTTGGCGAACCAGGCTGCT
TGTGGTCATTTAATTATTTCTTTTATAATAAGAAATTAAAACGAATTGTT
TTTTTTACAAGTCGAGCAGTGAATTCTCTTTACGCCGGTGAAACCTTACC
CTTTTCGATGGAAGAAGAAGTGTACTGAGAAAGTGTTTACACCAGTTTAA
AAAATTTTCTAAATTTATTGGAGATGCCAAAATGTTTTAAGATGTTATTA
TATTTTAGAGCTTCTCTTTTATTATTAAACGTATCTTTAAATAAAAAAAA
AAAAAAAAAAAA

LD17963.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG40196-RB 1399 CG40196-RB 239..1287 1..1044 5130 99.4 Plus
CG40196-RA 1269 CG40196-RA 109..1157 1..1044 5130 99.4 Plus
CG40196.a 2371 CG40196.a 109..1157 1..1044 5130 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrU 10048995 chrU 3448788..3449135 1..348 1740 100 Plus
chrU 10048995 chrU 1092217..1092498 873..592 1395 99.6 Minus
chrU 10048995 chrU 3449186..3449433 348..595 1240 100 Plus
chrU 10048995 chrU 1092549..1092796 595..348 1240 100 Minus
chrU 10048995 chrU 1097660..1097869 210..1 1050 100 Minus
chrU 10048995 chrU 1091995..1092163 1042..874 845 100 Minus
chrU 10048995 chrU 1092847..1092989 348..206 715 100 Minus
chrU 10048995 chrU 3449484..3449614 592..722 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
CR41604-RD 940 CR41604-RD 223..940 1..718 3590 100 Plus
CR41604-RC 909 CR41604-RC 192..909 1..718 3590 100 Plus
CR41604-RB 716 CR41604-RB 1..716 3..718 3580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 1515890..1516171 873..592 1395 99.6 Minus
2R 25286936 2R 1516222..1516469 595..348 1240 100 Minus
2R 25286936 2R 1521333..1521542 210..1 1050 100 Minus
2R 25286936 2R 1515666..1515836 1044..874 855 100 Minus
2R 25286936 2R 1516520..1516662 348..206 715 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 1515890..1516171 873..592 1395 99.6 Minus
2R 25260384 2R 1516222..1516469 595..348 1240 100 Minus
2R 25260384 2R 1521333..1521542 210..1 1050 100 Minus
2R 25260384 2R 1515666..1515836 1044..874 855 100 Minus
2R 25260384 2R 1516520..1516662 348..206 715 100 Minus
Blast to na_te.dros performed 2019-03-16 00:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
pogo 2121 pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). 1784..1995 57..268 124 55 Plus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6413..6471 859..801 123 71.7 Minus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 1966..2107 274..135 120 57.9 Minus

LD17963.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:36:58 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
chrU 3448788..3449135 1..348 100 -> Plus
chrU 3449187..3449433 349..595 100 -> Plus
chrU 3449488..3449614 596..722 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:34 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CG40196-RB 1..681 248..928 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:38:39 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CG40196-RB 1..681 248..928 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:14 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
Maf1-RC 1..681 248..928 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:24 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CG40196-RB 1..681 248..928 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:06:40 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
Maf1-RB 1..681 248..928 99   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:05:26 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CR41604-RC 192..909 1..718 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:46:41 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CG40196-RB 1..1047 1..1042 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:38:39 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CG40196-RB 239..1285 1..1042 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:14 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
Maf1-RA 109..1155 1..1042 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:24 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
CG40196-RB 1..1047 1..1042 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:06:40 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
Maf1-RA 109..1155 1..1042 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:58 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1516520..1516661 207..348 100 <- Minus
2R 1516222..1516468 349..595 100 <- Minus
2R 1515890..1516167 596..873 99 <- Minus
2R 1515668..1515836 874..1042 100 <- Minus
2R 1521332..1521542 1..206 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:58 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1516520..1516661 207..348 100 <- Minus
2R 1516222..1516468 349..595 100 <- Minus
2R 1515890..1516167 596..873 99 <- Minus
2R 1515668..1515836 874..1042 100 <- Minus
2R 1521332..1521542 1..206 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:58 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1516520..1516661 207..348 100 <- Minus
2R 1516222..1516468 349..595 100 <- Minus
2R 1515890..1516167 596..873 99 <- Minus
2R 1515668..1515836 874..1042 100 <- Minus
2R 1521332..1521542 1..206 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:14 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
ArmU 3449483..3449609 596..722 100 == Plus
ArmU 3448783..3449130 1..348 100 -> Plus
ArmU 3449182..3449428 349..595 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:50 Download gff for LD17963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1515890..1516167 596..873 99 <- Minus
2R 1516222..1516468 349..595 100 <- Minus
2R 1516520..1516661 207..348 100 <- Minus
2R 1521332..1521542 1..206 97   Minus
2R 1515668..1515836 874..1042 100 <- Minus

LD17963.pep Sequence

Translation from 247 to 927

> LD17963.pep
MKLLESSRFEAINNALSIQTSGITIFGRIESYSCKMVAAEKVLYKRFTAD
SHGHDLQALSPPQTLADFSPNFRRNNSQSGDEGITLCDTISRKTLFYLIA
TLNASFEPDYDFSEAKSHEFSKEPSLQWVMNSIHANLSALAGDQYQAIRQ
PLWSAVDDEVILSECDIYSYNPDLSCDPFGEPGCLWSFNYFFYNKKLKRI
VFFTSRAVNSLYAGETLPFSMEEEVY*

LD17963.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13945-PA 226 GF13945-PA 1..226 1..226 1155 95.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23116-PA 226 GG23116-PA 1..226 1..226 1194 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13563-PA 2938 GH13563-PA 1..208 1..208 1059 91.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Maf1-PE 226 CG40196-PE 1..226 1..226 1182 99.6 Plus
Maf1-PD 226 CG40196-PD 1..226 1..226 1182 99.6 Plus
Maf1-PB 226 CG40196-PB 1..226 1..226 1182 99.6 Plus
Maf1-PC 226 CG40196-PC 1..226 1..226 1182 99.6 Plus
Maf1-PA 226 CG40196-PA 1..226 1..226 1182 99.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19510-PA 226 GI19510-PA 1..226 1..226 1116 90.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18984-PA 51 GL18984-PA 1..40 1..40 178 87.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23260-PA 226 GM23260-PA 1..226 1..226 1205 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21993-PA 226 GJ21993-PA 1..226 1..226 1124 91.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23514-PA 225 GK23514-PA 1..223 1..223 1100 90.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20780-PA 226 GE20780-PA 1..226 1..226 1194 98.7 Plus

LD17963.hyp Sequence

Translation from 247 to 721

> LD17963.hyp
MKLLESSRFEAINNALSIQTSGITIFGRIESYSCKMVAAEKVLYKRFTAD
SHGHDLQALSPPQTLADFSPNFRRNNSQSGDEGITLCDTISRKTLFYLIA
TLNASFEPDYDFSEAKSHEFSKEPSLQWVMNSIHANLSALAGDQYQAIRQ
PLWSAVDD

LD17963.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Maf1-PE 226 CG40196-PE 1..158 1..158 809 99.4 Plus
Maf1-PD 226 CG40196-PD 1..158 1..158 809 99.4 Plus
Maf1-PB 226 CG40196-PB 1..158 1..158 809 99.4 Plus
Maf1-PC 226 CG40196-PC 1..158 1..158 809 99.4 Plus
Maf1-PA 226 CG40196-PA 1..158 1..158 809 99.4 Plus