Clone LD18018 Report

Search the DGRC for LD18018

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:180
Well:18
Vector:pBS SK-
Associated Gene/Transcriptarx-RA
Protein status:LD18018.pep: gold
Preliminary Size:1019
Sequenced Size:850

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3893 2001-01-01 Release 2 assignment
CG3893 2002-04-04 Blastp of sequenced clone
CG3893 2003-01-01 Sim4 clustering to Release 3
CG3893 2008-04-29 Release 5.5 accounting
CG3893 2008-08-15 Release 5.9 accounting
CG3893 2008-12-18 5.12 accounting

Clone Sequence Records

LD18018.complete Sequence

850 bp (850 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095030

> LD18018.complete
AATAACTACGACGAATCCGATATGGTTTATTGCCCGTACAACAAGGAGCA
CAAAATGCTGCGCAAGAAGCTCCAGCAGCACATCTTAAAATGCCGTGTGA
TCTACAAAGACACGGTGGAACTTATGGTTTGTCCCTTCAATAGTTCCCAT
TTGATACCAGAGCCCCAGTTCTTTCAACACACCCAATCGTGCGAGGATCG
AAACATTATAGTACACTATCAGACCAGCGCTCCTGCTGTCCTCAGCGAAG
ACACCAGACACGCGAAGATCGAGTCCGAGGAGAACTGGGATGACGACGAG
AGTGTGCCCGATTACGATCCTCAGGTCTACTGTTCCAGGGCCAACATAGT
GAGAGAGCCCAATGGGTTGTTTCCCGCCCAGCGAAGGGCTTTCATCGAGC
AGGAAAAACGTCGTCACTTTGGCGAGGATTACGAGGAGGAGAAGAAGCCG
CGGAAGGCCAAGGCTCGCGCGGATCTTCGTCCCACTCCCTACGAGCACAG
GAGGCCATACTCAAGGCGCCAGTAGTTCGTGTTCATCAAGAATTACTCCC
ACTGCCAAAGAACAAAAACCAAAACATTTTATCGGGGCTTATACTCGTTA
TTATAACCAAAAAAAACAATTCCACGGCCAAATTGTTAAAATTAACATGT
GCTGTGAAACAAGTATTGCTCGCAGTTCAGATGAGCAAATGACAAAATCA
ATCTCATATTATTCTGAGATAATGAAAATAACATACATATCCCAAATTCA
TGTACATGTGTAAACTATGTGCCTTTTTCCATTAACGACACAGATAATCG
TGAAATAAAGCATTTCACTTTGTTTCTTATCAAAAAAAAAAAAAAAAAAA

LD18018.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG3893-RA 919 CG3893-RA 81..919 1..839 4195 100 Plus
CG3893.a 919 CG3893.a 81..919 1..839 4195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18890222..18890882 831..175 3085 98.5 Minus
chr3L 24539361 chr3L 18890951..18891124 174..1 870 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18900587..18901251 839..175 3325 100 Minus
3L 28110227 3L 18901320..18901493 174..1 870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18893687..18894351 839..175 3325 100 Minus
3L 28103327 3L 18894420..18894593 174..1 870 100 Minus
Blast to na_te.dros performed 2019-03-16 10:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
1731 4648 1731 DMTN1731 4648bp Derived from X07656 (g8700) (Rel. 36, Last updated, Version 6). 1257..1327 635..704 135 70.8 Plus

LD18018.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:26:40 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18890222..18890882 175..831 98 <- Minus
chr3L 18890951..18891124 1..174 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:37 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..504 22..525 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:29:07 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..504 22..525 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:50:56 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..504 22..525 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:19:25 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..504 22..525 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:06:55 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
arx-RA 1..504 22..525 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:58:17 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:29:07 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:50:56 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 62..892 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:19:26 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
CG3893-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:06:55 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
arx-RA 62..892 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:40 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18900595..18901251 175..831 100 <- Minus
3L 18901320..18901493 1..174 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:40 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18900595..18901251 175..831 100 <- Minus
3L 18901320..18901493 1..174 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:40 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18900595..18901251 175..831 100 <- Minus
3L 18901320..18901493 1..174 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:50:56 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18894420..18894593 1..174 100   Minus
arm_3L 18893695..18894351 175..831 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:00 Download gff for LD18018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18894420..18894593 1..174 100   Minus
3L 18893695..18894351 175..831 100 <- Minus

LD18018.hyp Sequence

Translation from 0 to 524

> LD18018.hyp
NNYDESDMVYCPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSH
LIPEPQFFQHTQSCEDRNIIVHYQTSAPAVLSEDTRHAKIESEENWDDDE
SVPDYDPQVYCSRANIVREPNGLFPAQRRAFIEQEKRRHFGEDYEEEKKP
RKAKARADLRPTPYEHRRPYSRRQ*

LD18018.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
arx-PA 167 CG3893-PA 1..167 8..174 910 100 Plus
CG32625-PA 144 CG32625-PA 9..136 7..138 172 28.4 Plus
CG34283-PA 153 CG34283-PA 19..147 11..138 170 26.2 Plus

LD18018.pep Sequence

Translation from 21 to 524

> LD18018.pep
MVYCPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQF
FQHTQSCEDRNIIVHYQTSAPAVLSEDTRHAKIESEENWDDDESVPDYDP
QVYCSRANIVREPNGLFPAQRRAFIEQEKRRHFGEDYEEEKKPRKAKARA
DLRPTPYEHRRPYSRRQ*

LD18018.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10800-PA 175 GF10800-PA 9..167 1..157 621 73.1 Plus
Dana\GF23650-PA 163 GF23650-PA 17..161 1..151 184 30.5 Plus
Dana\GF22344-PA 154 GF22344-PA 18..135 2..119 160 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13445-PA 173 GG13445-PA 9..169 1..161 733 90.7 Plus
Dere\GG19487-PA 147 GG19487-PA 11..135 2..126 177 35.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16964-PA 173 GH16964-PA 1..146 1..147 540 66.7 Plus
Dgri\GH14602-PA 149 GH14602-PA 10..148 1..135 200 35 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
arx-PA 167 CG3893-PA 1..167 1..167 910 100 Plus
CG32625-PA 144 CG32625-PA 11..136 2..131 171 28.8 Plus
CG34283-PA 153 CG34283-PA 19..147 4..131 170 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11828-PA 179 GI11828-PA 9..173 1..158 579 66.3 Plus
Dmoj\GI13489-PA 145 GI13489-PA 9..140 1..131 213 36.2 Plus
Dmoj\GI19179-PA 179 GI19179-PA 40..161 2..122 153 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15775-PA 173 GL15775-PA 9..170 1..166 489 56.9 Plus
Dper\GL19847-PA 156 GL19847-PA 20..149 4..131 167 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17756-PA 167 GA17756-PA 1..164 1..166 570 64.5 Plus
Dpse\GA26086-PA 173 GA26086-PA 9..170 1..166 498 58.1 Plus
Dpse\GA27350-PA 156 GA27350-PA 20..149 4..131 157 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14914-PA 175 GM14914-PA 9..175 1..167 840 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12322-PA 175 GD12322-PA 9..175 1..167 837 94 Plus
Dsim\GD23063-PA 144 GD23063-PA 8..139 1..131 155 31.1 Plus
Dsim\GD24515-PA 135 GD24515-PA 11..127 2..131 136 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13528-PA 171 GJ13528-PA 1..165 1..158 570 62.7 Plus
Dvir\GJ11850-PA 148 GJ11850-PA 10..146 1..135 220 35.5 Plus
Dvir\GJ19312-PA 164 GJ19312-PA 29..159 2..131 218 34.1 Plus
Dvir\GJ20240-PA 173 GJ20240-PA 33..163 2..131 208 33.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12656-PA 163 GK12656-PA 6..162 1..158 533 62.7 Plus
Dwil\GK20915-PA 156 GK20915-PA 9..156 1..149 518 61.7 Plus
Dwil\GK16207-PA 689 GK16207-PA 22..126 2..105 163 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22548-PA 162 GE22548-PA 1..162 1..167 709 87.4 Plus
Dyak\GE22544-PA 162 GE22544-PA 1..162 1..167 709 87.4 Plus
Dyak\GE16140-PA 147 GE16140-PA 11..135 2..126 160 33.6 Plus